Result : EXP00307
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00307 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 1755006 |
| Right | 1755119 |
| Strand | - |
| Nucleotide Sequence | ATGAACTGTACCGAGAAATGTGCAGAGTTGTCGGTAAAGTTGTGCTGGAAATGCGCGATCTGGGGCAGGAACCAAAGCATATTGTTATCGCAGGCGTATTACGTACAGCATTAG |
| Sequence | MNCTEKCAELSVKLCWKCAIWGRNQSILLSQAYYVQH |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 27013550 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 37 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1735807 | 1735920 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 2 | 2354855 | 2354968 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 3 | 1755006 | 1755119 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 4 | 1867705 | 1867818 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 5 | 1689666 | 1689782 | - | NZ_AP014857.1 | Escherichia albertii |
| 6 | 1473830 | 1473934 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_004337.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01314.20 | 0.6 | 3 | 1176.5 | same-strand | Aldehyde ferredoxin oxidoreductase, domains 2 & 3 |
| 2 | PF00037.29 | 1.0 | 5 | 2208 | same-strand | 4Fe-4S binding domain |
| 3 | PF12837.9 | 1.0 | 5 | 2208 | same-strand | 4Fe-4S binding domain |
| 4 | PF12838.9 | 1.0 | 5 | 2208 | same-strand | 4Fe-4S dicluster domain |
| 5 | PF13237.8 | 1.0 | 5 | 2208 | same-strand | 4Fe-4S dicluster domain |
| 6 | PF13247.8 | 1.0 | 5 | 2208 | same-strand | 4Fe-4S dicluster domain |
| 7 | PF13187.8 | 1.0 | 5 | 2208 | same-strand | 4Fe-4S dicluster domain |
| 8 | PF12797.9 | 0.8 | 4 | 530 | same-strand | 4Fe-4S binding domain |
| 9 | PF10965.10 | 1.0 | 5 | -113.0 | same-strand | Protein of unknown function (DUF2767) |
| 10 | PF00224.23 | 0.8 | 4 | 579 | opposite-strand | Pyruvate kinase, barrel domain |
| 11 | PF02887.18 | 0.8 | 4 | 579 | opposite-strand | Pyruvate kinase, alpha/beta domain |
| 12 | PF04728.15 | 0.8 | 4 | 2302 | opposite-strand | Lipoprotein leucine-zipper |
| 13 | PF17969.3 | 0.8 | 4 | 2602 | same-strand | L,D-transpeptidase C-terminal domain |
| 14 | PF03734.16 | 0.8 | 4 | 2602 | same-strand | L,D-transpeptidase catalytic domain |
| 15 | PF01476.22 | 0.8 | 4 | 2602 | same-strand | LysM domain |
| 16 | PF02657.17 | 0.6 | 3 | 3754.5 | same-strand | Fe-S metabolism associated domain |
++ More..