ProsmORF-pred
Result : EXP00301
Protein Information
Information Type Description
Protein name EXP00301
NCBI Accession ID NC_000913.3
Organism Escherichia coli str. K-12 substr. MG1655
Left 2265957
Right 2266109
Strand -
Nucleotide Sequence GTGTTCAGGAAGCGCAAAATAGAAGATTGGTATAATAAATTAAAAAAGGGACAGCCTGAGCTATCCCTTTTCTGCATGCGGCTGAAGTTAGTCAGCACGCCCCATATAACGGCGTTCTTCGATATGGATACGAATTTTTTCGCCCGGGCTTAA
Sequence VFRKRKIEDWYNKLKKGQPELSLFCMRLKLVSTPHITAFFDMDTNFFARA
Source of smORF Ribo-seq
Function
Pubmed ID 30904393 27013550
Domain
Functional Category Function not yet assigned
Uniprot ID
ORF Length (Amino Acid) 50
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 3
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 3001021 3001173 - NC_002695.2 Escherichia coli O157:H7 str. Sakai
2 2265957 2266109 - NC_000913.3 Escherichia coli str. K-12 substr. MG1655
3 2289159 2289311 - NC_004337.2 Shigella flexneri 2a str. 301
4 2756038 2756190 - NZ_CP061527.1 Shigella dysenteriae
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_002695.2
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF00359.24 0.67 2 2462 same-strand Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2
2 PF00381.21 0.67 2 2462 same-strand PTS HPr component phosphorylation site
3 PF07690.18 1.0 3 913.0 opposite-strand Major Facilitator Superfamily
4 PF12832.9 1.0 3 913.0 opposite-strand MFS 1 like family
5 PF03692.17 1.0 3 662.0 same-strand Putative zinc- or iron-chelating domain
6 PF09285.13 1.0 3 -65.0 opposite-strand Elongation factor P, C-terminal
7 PF08207.14 1.0 3 -65.0 opposite-strand Elongation factor P (EF-P) KOW-like domain
8 PF01132.22 1.0 3 -65.0 opposite-strand Elongation factor P (EF-P) OB domain
9 PF08125.15 1.0 3 136.0 opposite-strand Mannitol dehydrogenase C-terminal domain
10 PF01232.25 1.0 3 136.0 opposite-strand Mannitol dehydrogenase Rossmann domain
11 PF02492.21 1.0 3 1720.0 opposite-strand CobW/HypB/UreG, nucleotide-binding domain
12 PF07683.16 1.0 3 1720.0 opposite-strand Cobalamin synthesis protein cobW C-terminal domain
13 PF00877.21 1.0 3 3870.0 opposite-strand NlpC/P60 family
14 PF00563.22 1.0 3 4617.5 opposite-strand EAL domain
15 PF12792.9 1.0 3 4617.5 opposite-strand CSS motif domain associated with EAL
++ More..