Result : EXP00301
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00301 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 2265957 |
| Right | 2266109 |
| Strand | - |
| Nucleotide Sequence | GTGTTCAGGAAGCGCAAAATAGAAGATTGGTATAATAAATTAAAAAAGGGACAGCCTGAGCTATCCCTTTTCTGCATGCGGCTGAAGTTAGTCAGCACGCCCCATATAACGGCGTTCTTCGATATGGATACGAATTTTTTCGCCCGGGCTTAA |
| Sequence | VFRKRKIEDWYNKLKKGQPELSLFCMRLKLVSTPHITAFFDMDTNFFARA |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 27013550 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 50 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3001021 | 3001173 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 2265957 | 2266109 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 2289159 | 2289311 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 2756038 | 2756190 | - | NZ_CP061527.1 | Shigella dysenteriae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00359.24 | 0.67 | 2 | 2462 | same-strand | Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2 |
| 2 | PF00381.21 | 0.67 | 2 | 2462 | same-strand | PTS HPr component phosphorylation site |
| 3 | PF07690.18 | 1.0 | 3 | 913.0 | opposite-strand | Major Facilitator Superfamily |
| 4 | PF12832.9 | 1.0 | 3 | 913.0 | opposite-strand | MFS 1 like family |
| 5 | PF03692.17 | 1.0 | 3 | 662.0 | same-strand | Putative zinc- or iron-chelating domain |
| 6 | PF09285.13 | 1.0 | 3 | -65.0 | opposite-strand | Elongation factor P, C-terminal |
| 7 | PF08207.14 | 1.0 | 3 | -65.0 | opposite-strand | Elongation factor P (EF-P) KOW-like domain |
| 8 | PF01132.22 | 1.0 | 3 | -65.0 | opposite-strand | Elongation factor P (EF-P) OB domain |
| 9 | PF08125.15 | 1.0 | 3 | 136.0 | opposite-strand | Mannitol dehydrogenase C-terminal domain |
| 10 | PF01232.25 | 1.0 | 3 | 136.0 | opposite-strand | Mannitol dehydrogenase Rossmann domain |
| 11 | PF02492.21 | 1.0 | 3 | 1720.0 | opposite-strand | CobW/HypB/UreG, nucleotide-binding domain |
| 12 | PF07683.16 | 1.0 | 3 | 1720.0 | opposite-strand | Cobalamin synthesis protein cobW C-terminal domain |
| 13 | PF00877.21 | 1.0 | 3 | 3870.0 | opposite-strand | NlpC/P60 family |
| 14 | PF00563.22 | 1.0 | 3 | 4617.5 | opposite-strand | EAL domain |
| 15 | PF12792.9 | 1.0 | 3 | 4617.5 | opposite-strand | CSS motif domain associated with EAL |
++ More..