Result : EXP00297
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00297 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 1671001 |
| Right | 1671105 |
| Strand | - |
| Nucleotide Sequence | ATGAATCCGTTTATTTGGGTACTTATAATCCTGATGACGCTAGACGCGCTGCGGGAATTGGCTGGCGCTTCGTCTATTTTAGGATGGCTATTAACGTTGGTTTGA |
| Sequence | MNPFIWVLIILMTLDALRELAGASSILGWLLTLV |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 27013550 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 34 |
++ More..
| Conservation Analysis |
No. of Species: 34
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2270939 | 2271043 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 1671001 | 1671105 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 1645639 | 1645743 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 2137771 | 2137875 | + | NZ_LR134340.1 | Escherichia marmotae |
| 5 | 1614482 | 1614586 | - | NZ_AP014857.1 | Escherichia albertii |
| 6 | 2569110 | 2569202 | - | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 7 | 881448 | 881540 | + | NZ_CP027107.1 | Cronobacter sakazakii |
| 8 | 1616352 | 1616444 | + | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 9 | 2528235 | 2528327 | - | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 10 | 2610317 | 2610409 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 11 | 470641 | 470745 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 12 | 1449528 | 1449620 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 13 | 2925886 | 2925978 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 14 | 858416 | 858508 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 15 | 2528457 | 2528549 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 16 | 1547011 | 1547103 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 17 | 2236742 | 2236843 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 18 | 2805746 | 2805838 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 19 | 2930141 | 2930242 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 20 | 2726114 | 2726206 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 21 | 2843680 | 2843772 | - | NZ_CP054254.1 | Klebsiella variicola |
| 22 | 2513598 | 2513690 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 23 | 2677912 | 2678004 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 24 | 2244154 | 2244246 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 25 | 882360 | 882452 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 26 | 2764120 | 2764212 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 27 | 2642122 | 2642214 | + | NZ_CP050508.1 | Raoultella terrigena |
| 28 | 4679898 | 4679990 | - | NZ_CP026047.1 | Raoultella planticola |
| 29 | 2591371 | 2591463 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 30 | 2444372 | 2444464 | + | NZ_CP041247.1 | Raoultella electrica |
| 31 | 3277119 | 3277211 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 32 | 3711004 | 3711096 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 33 | 2156870 | 2156962 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 34 | 1562535 | 1562627 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 35 | 3959430 | 3959522 | + | NZ_CP053416.1 | Salmonella bongori |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP051548.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13500.8 | 0.82 | 28 | 3791 | same-strand | AAA domain |
| 2 | PF01656.25 | 0.82 | 28 | 3791 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
| 3 | PF00480.22 | 0.82 | 28 | 2443 | same-strand | ROK family |
| 4 | PF03466.22 | 0.82 | 28 | 1416.5 | same-strand | LysR substrate binding domain |
| 5 | PF00126.29 | 0.82 | 28 | 1416.5 | same-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
| 6 | PF13365.8 | 0.68 | 23 | 2388.5 | opposite-strand | Trypsin-like peptidase domain |
| 7 | PF02074.17 | 0.62 | 21 | 195 | opposite-strand | Carboxypeptidase Taq (M32) metallopeptidase |
++ More..