Result : B1GZ85
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L23 |
| NCBI Accession ID | AP009510.1 |
| Organism | Endomicrobium trichonymphae |
| Left | 151034 |
| Right | 151324 |
| Strand | + |
| Nucleotide Sequence | ATGGATATCAGAAACATTATTAAGAGACCGATAGTAACGGAAAAAGCTGTACTTATGAAAGAAAAAAGCAATAAATATACTTTTGTGGTAGATAAAAGCGCAAATAAGTTTCAGATAAAGTATGCTGTCGAAACTCTATTTAATGTAAAAGTAAAGAGTGTGCATACTTCAAACTGCGTGGGAAAAAGCCTGAAAGTCGGCAGGTATGCTGCTGGCTACAGGAGCGATTGGAAAAAAGCAATAGTAAAACTCGGCAAAGGGCAGGAGATTCAATTAGCCGACAAAGTCTGA |
| Sequence | MDIRNIIKRPIVTEKAVLMKEKSNKYTFVVDKSANKFQIKYAVETLFNVKVKSVHTSNCVGKSLKVGRYAAGYRSDWKKAIVKLGKGQEIQLADKV |
| Source of smORF | Swiss-Prot |
| Function | One of the early assembly proteins it binds 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome. Forms the main docking site for trigger factor binding to the ribosome. {ECO:0000255|HAMAP-Rule:MF_01369}. |
| Pubmed ID | 18391199 |
| Domain | CDD:412311 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B1GZ85 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 255
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1550805 | 1551092 | + | NZ_CP009498.1 | Endomicrobium proavitum |
| 2 | 1081887 | 1082165 | + | NZ_CP035108.1 | Geovibrio thiophilus |
| 3 | 2775225 | 2775512 | - | NC_013205.1 | Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 |
| 4 | 1555722 | 1556000 | - | NC_014758.1 | Calditerrivibrio nitroreducens DSM 19672 |
| 5 | 2259110 | 2259346 | - | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 6 | 1783699 | 1783947 | - | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 7 | 1761659 | 1761940 | - | NZ_LR134484.1 | Gemella haemolysans |
| 8 | 1640607 | 1640888 | - | NC_015437.1 | Selenomonas sputigena ATCC 35185 |
| 9 | 723950 | 724234 | + | NC_008609.1 | Pelobacter propionicus DSM 2379 |
| 10 | 3679500 | 3679763 | - | NC_011831.1 | Chloroflexus aggregans DSM 9485 |
| 11 | 48694 | 48975 | + | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 12 | 392960 | 393241 | + | NC_013943.1 | Denitrovibrio acetiphilus DSM 12809 |
| 13 | 193441 | 193722 | - | NZ_CP046314.1 | Gemella morbillorum |
| 14 | 2132821 | 2133072 | - | NC_013740.1 | Acidaminococcus fermentans DSM 20731 |
| 15 | 272253 | 272489 | + | NC_022549.1 | Acholeplasma brassicae |
| 16 | 2748876 | 2749118 | - | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
| 17 | 1452314 | 1452550 | - | NC_022538.1 | Acholeplasma palmae J233 |
| 18 | 2597336 | 2597581 | - | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 19 | 1657492 | 1657749 | - | NC_015388.1 | Desulfobacca acetoxidans DSM 11109 |
| 20 | 145411 | 145698 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 21 | 701595 | 701879 | + | NC_007517.1 | Geobacter metallireducens GS-15 |
| 22 | 2071902 | 2072138 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 23 | 463179 | 463466 | + | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 24 | 1143204 | 1143488 | + | NZ_CP053187.1 | Turicibacter sanguinis |
| 25 | 64562 | 64795 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 26 | 2007019 | 2007300 | + | NZ_LT996885.1 | Dialister massiliensis |
| 27 | 1483248 | 1483517 | - | NZ_AP017470.1 | Thermotomaculum hydrothermale |
| 28 | 148860 | 149147 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 29 | 1097973 | 1098263 | + | NZ_AP019004.1 | Phascolarctobacterium faecium |
| 30 | 354642 | 354935 | + | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 31 | 2256120 | 2256413 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 32 | 55507 | 55794 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 33 | 430827 | 431120 | + | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 34 | 345077 | 345313 | + | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 35 | 576330 | 576581 | + | NZ_CP013290.1 | Janibacter indicus |
| 36 | 280366 | 280605 | + | NZ_CP014204.2 | Clostridium baratii |
| 37 | 938274 | 938516 | + | NZ_CP067016.1 | Anaerococcus obesiensis |
| 38 | 322973 | 323215 | + | NZ_CP066014.1 | Anaerococcus vaginalis |
| 39 | 405063 | 405308 | + | NZ_CP048436.1 | Flavonifractor plautii |
| 40 | 163744 | 163977 | - | NZ_AP017312.1 | Aneurinibacillus soli |
| 41 | 181189 | 181476 | + | NZ_CP034118.1 | Staphylospora marina |
| 42 | 2660564 | 2660803 | - | NZ_HG917868.1 | Clostridium bornimense |
| 43 | 692518 | 692754 | + | NZ_LT635772.1 | Anaerococcus mediterraneensis |
| 44 | 2210112 | 2210348 | + | NZ_CP058952.1 | Chitinibacter fontanus |
| 45 | 882213 | 882503 | + | NC_014972.1 | Desulfobulbus propionicus DSM 2032 |
| 46 | 4077668 | 4077916 | + | NZ_CP043473.1 | Chromobacterium paludis |
| 47 | 428471 | 428719 | + | NZ_AP019312.1 | Chromobacterium haemolyticum |
| 48 | 2292914 | 2293207 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 49 | 142995 | 143282 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 50 | 140279 | 140512 | + | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 51 | 2496256 | 2496546 | - | NZ_CP017237.1 | Moorella thermoacetica |
| 52 | 1403454 | 1403693 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 53 | 3318211 | 3318450 | - | NC_016894.1 | Acetobacterium woodii DSM 1030 |
| 54 | 1039247 | 1039486 | - | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 55 | 3450598 | 3450888 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 56 | 415983 | 416276 | + | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 57 | 3269677 | 3269910 | - | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 58 | 1942417 | 1942710 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 59 | 2013261 | 2013554 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 60 | 2541988 | 2542275 | - | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 61 | 1373243 | 1373530 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 62 | 289123 | 289407 | + | NC_011060.1 | Pelodictyon phaeoclathratiforme BU-1 |
| 63 | 2210311 | 2210559 | + | NZ_CP029495.1 | Chromobacterium phragmitis |
| 64 | 745005 | 745289 | + | NZ_CP009788.1 | Geobacter pickeringii |
| 65 | 1962648 | 1962941 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 66 | 314506 | 314790 | + | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 67 | 241328 | 241579 | + | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 68 | 2577258 | 2577545 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 69 | 3935622 | 3935855 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 70 | 1760007 | 1760306 | - | NZ_CP044548.2 | Janibacter melonis |
| 71 | 4513490 | 4513738 | - | NC_005085.1 | Chromobacterium violaceum ATCC 12472 |
| 72 | 170776 | 171063 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 73 | 2174185 | 2174475 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 74 | 2216280 | 2216528 | + | NZ_AP019307.1 | Nocardioides baekrokdamisoli |
| 75 | 287869 | 288150 | + | NZ_CP030032.1 | Bradymonas sediminis |
| 76 | 3676662 | 3676901 | - | NZ_CP028842.1 | Clostridium botulinum |
| 77 | 3957787 | 3958026 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 78 | 3566998 | 3567246 | + | NZ_CP017707.1 | Chromobacterium vaccinii |
| 79 | 4435471 | 4435770 | - | NZ_CP011112.1 | Luteipulveratus mongoliensis |
| 80 | 1586783 | 1587094 | - | NC_009664.2 | Kineococcus radiotolerans SRS30216 = ATCC BAA-149 |
| 81 | 110274 | 110561 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 82 | 1408343 | 1408630 | - | NZ_CP043404.1 | Bacillus safensis |
| 83 | 3758050 | 3758289 | - | NC_014624.2 | Eubacterium callanderi |
| 84 | 2165340 | 2165579 | - | NZ_CP029487.1 | Eubacterium maltosivorans |
| 85 | 1377887 | 1378126 | + | NZ_CP019962.1 | Eubacterium limosum |
| 86 | 1061995 | 1062282 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 87 | 1491277 | 1491564 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 88 | 1523035 | 1523316 | - | NZ_LT906446.1 | Megamonas hypermegale |
| 89 | 551340 | 551642 | + | NZ_CP017812.1 | Boudabousia tangfeifanii |
| 90 | 1825868 | 1826101 | - | NZ_CP035130.1 | Gudongella oleilytica |
| 91 | 4576247 | 4576483 | - | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 92 | 3077390 | 3077641 | - | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 93 | 607067 | 607330 | + | NC_014148.1 | Planctopirus limnophila DSM 3776 |
| 94 | 158118 | 158408 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 95 | 4046534 | 4046821 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 96 | 2265447 | 2265686 | - | NZ_LT906477.1 | Clostridium cochlearium |
| 97 | 200953 | 201237 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 98 | 4133800 | 4134084 | - | NZ_CP031223.1 | Psychrobacillus glaciei |
| 99 | 192366 | 192599 | + | NZ_CP043998.1 | Clostridium diolis |
| 100 | 220435 | 220668 | + | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 101 | 152918 | 153208 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 102 | 1755135 | 1755419 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 103 | 1229676 | 1229909 | - | NZ_LR134523.1 | Peptoniphilus ivorii |
| 104 | 131673 | 131960 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 105 | 3793302 | 3793589 | - | NZ_CP011937.1 | Bacillus velezensis |
| 106 | 137952 | 138239 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 107 | 136992 | 137279 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 108 | 272980 | 273267 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 109 | 136933 | 137220 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 110 | 136693 | 136980 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 111 | 136819 | 137106 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 112 | 106713 | 107000 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 113 | 1872422 | 1872709 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 114 | 1508172 | 1508447 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 115 | 3983768 | 3984001 | + | NZ_CP016809.1 | Paenibacillus ihbetae |
| 116 | 828432 | 828728 | - | NC_010003.1 | Petrotoga mobilis SJ95 |
| 117 | 1729369 | 1729662 | - | NZ_CP014209.1 | Isoptericola dokdonensis DS-3 |
| 118 | 270308 | 270562 | - | NZ_LT996886.1 | Tessaracoccus timonensis |
| 119 | 138245 | 138535 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 120 | 2697628 | 2697912 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 121 | 2739529 | 2739795 | - | NZ_CP072793.1 | Thiothrix unzii |
| 122 | 747808 | 748041 | + | NC_015682.1 | Thermodesulfobacterium geofontis OPF15 |
| 123 | 221369 | 221650 | + | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 124 | 787266 | 787541 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 125 | 617053 | 617331 | + | NZ_CP004387.1 | Alcanivorax pacificus W11-5 |
| 126 | 2272076 | 2272351 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 127 | 215313 | 215546 | + | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 128 | 2574726 | 2575010 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 129 | 244767 | 245051 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 130 | 195327 | 195560 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 131 | 5035406 | 5035639 | - | NZ_CP017147.1 | Bosea vaviloviae |
| 132 | 129341 | 129574 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 133 | 1216012 | 1216248 | - | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 134 | 1813024 | 1813260 | - | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 135 | 1003689 | 1003925 | + | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 136 | 2403800 | 2404036 | - | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 137 | 2438960 | 2439244 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 138 | 699074 | 699307 | + | NC_016148.1 | Thermovirga lienii DSM 17291 |
| 139 | 610731 | 611006 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 140 | 1554249 | 1554485 | - | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 141 | 2951911 | 2952144 | - | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 142 | 2305354 | 2305653 | - | NZ_LT906453.1 | Dermatophilus congolensis |
| 143 | 756121 | 756396 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 144 | 138844 | 139128 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 145 | 1437905 | 1438180 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 146 | 1473370 | 1473654 | - | NC_016630.1 | Filifactor alocis ATCC 35896 |
| 147 | 7136848 | 7137081 | - | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 148 | 1635681 | 1635938 | + | NZ_CP034248.1 | Paenibacillus lentus |
| 149 | 419019 | 419294 | + | NC_016041.1 | Glaciecola nitratireducens FR1064 |
| 150 | 651627 | 651902 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 151 | 1038905 | 1039141 | + | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 152 | 1146269 | 1146505 | + | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 153 | 1819299 | 1819535 | - | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 154 | 2195072 | 2195362 | - | NZ_AP019822.1 | Pseudoleptotrichia goodfellowii |
| 155 | 132232 | 132516 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 156 | 974998 | 975234 | + | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 157 | 1129255 | 1129488 | - | NZ_CP048429.1 | Paenibacillus jilunlii |
| 158 | 6435925 | 6436158 | - | NZ_CP009287.1 | Paenibacillus graminis |
| 159 | 1151580 | 1151813 | - | NZ_CP068595.1 | Paenibacillus sonchi |
| 160 | 1728916 | 1729191 | - | NZ_LT906464.1 | Staphylococcus muscae |
| 161 | 234823 | 235056 | + | NZ_CP017253.2 | Clostridium taeniosporum |
| 162 | 709406 | 709681 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 163 | 761492 | 761767 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 164 | 981525 | 981788 | - | NZ_CP049255.1 | Microbacterium endophyticum |
| 165 | 4437514 | 4437753 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 166 | 2316216 | 2316491 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 167 | 6157632 | 6157865 | - | NZ_CP009428.1 | Paenibacillus odorifer |
| 168 | 5020287 | 5020520 | - | NZ_CP009286.1 | Paenibacillus stellifer |
| 169 | 5287891 | 5288130 | - | NZ_CP020953.1 | Clostridium drakei |
| 170 | 4636071 | 4636310 | + | NZ_CP009933.1 | Clostridium scatologenes |
| 171 | 35587 | 35826 | - | NZ_CP036523.1 | Peptacetobacter hiranonis |
| 172 | 4388064 | 4388297 | + | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 173 | 4500450 | 4500689 | - | NC_014393.1 | Clostridium cellulovorans 743B |
| 174 | 267988 | 268227 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 175 | 4690671 | 4690904 | - | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 176 | 5297740 | 5297973 | - | NZ_CP009288.1 | Paenibacillus durus |
| 177 | 3350324 | 3350614 | - | NZ_CP040924.1 | Clostridium thermarum |
| 178 | 7400798 | 7401031 | - | NZ_CP009285.1 | Paenibacillus borealis |
| 179 | 560998 | 561237 | + | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 180 | 1156579 | 1156875 | + | NZ_AP018712.1 | Tepiditoga spiralis |
| 181 | 874574 | 874873 | - | NC_016751.1 | Marinitoga piezophila KA3 |
| 182 | 6282624 | 6282857 | - | NZ_CP021780.1 | Paenibacillus donghaensis |
| 183 | 1594779 | 1595051 | + | NZ_CP020612.1 | Paracoccus contaminans |
| 184 | 2602153 | 2602407 | - | NZ_CP044117.1 | Roseomonas mucosa |
| 185 | 5135661 | 5135894 | - | NZ_CP013023.1 | Paenibacillus bovis |
| 186 | 3147382 | 3147633 | + | NZ_CP035810.1 | Brevibacterium luteolum |
| 187 | 3443591 | 3443881 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 188 | 2076895 | 2077131 | - | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 189 | 4444125 | 4444361 | - | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 190 | 311762 | 311995 | + | NC_019897.1 | Thermobacillus composti KWC4 |
| 191 | 2426452 | 2426691 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 192 | 59994 | 60251 | - | NZ_CP060244.1 | Entomobacter blattae |
| 193 | 2133432 | 2133716 | - | NZ_AP019829.2 | Leptotrichia wadei |
| 194 | 334636 | 334932 | + | NC_008530.1 | Lactobacillus gasseri ATCC 33323 = JCM 1131 |
| 195 | 337583 | 337879 | + | NZ_AP018549.1 | Lactobacillus paragasseri |
| 196 | 252922 | 253161 | + | NZ_CP016786.1 | Clostridium isatidis |
| 197 | 6316268 | 6316558 | - | NZ_CP048209.1 | Paenibacillus lycopersici |
| 198 | 1549273 | 1549578 | - | NZ_CP015444.1 | Lactobacillus helveticus |
| 199 | 395219 | 395524 | + | NZ_CP059829.1 | Lactobacillus ultunensis |
| 200 | 292228 | 292530 | + | NC_021181.2 | Lactobacillus acidophilus La-14 |
| 201 | 166112 | 166396 | + | NZ_AP019827.1 | Leptotrichia shahii |
| 202 | 482113 | 482349 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 203 | 215168 | 215401 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 204 | 2373350 | 2373589 | - | NC_018664.1 | Gottschalkia acidurici 9a |
| 205 | 339341 | 339637 | + | NZ_CP059276.1 | Lactobacillus taiwanensis |
| 206 | 4100217 | 4100486 | - | NZ_CP029553.1 | Methylobacterium terrae |
| 207 | 1059826 | 1060128 | + | NZ_CP023564.1 | Brachybacterium ginsengisoli |
| 208 | 3396491 | 3396754 | - | NZ_CP011853.1 | Gordonia phthalatica |
| 209 | 3622926 | 3623216 | - | NZ_CP014167.1 | Paenibacillus yonginensis |
| 210 | 170401 | 170691 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 211 | 51070 | 51357 | - | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 212 | 2879855 | 2880088 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 213 | 1719617 | 1719922 | + | NZ_LT635457.1 | Actinomyces pacaensis |
| 214 | 625254 | 625514 | - | NC_019892.1 | Singulisphaera acidiphila DSM 18658 |
| 215 | 173125 | 173394 | + | NZ_LN824141.1 | Defluviitoga tunisiensis |
| 216 | 2901043 | 2901276 | - | NC_017956.1 | Tistrella mobilis KA081020-065 |
| 217 | 129360 | 129596 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 218 | 2823012 | 2823248 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 219 | 143739 | 143975 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 220 | 2266765 | 2267001 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 221 | 348791 | 349027 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 222 | 3259103 | 3259375 | + | NZ_CP037953.1 | Permianibacter aggregans |
| 223 | 631792 | 632028 | - | NZ_CP009312.1 | Lawsonella clevelandensis |
| 224 | 2285755 | 2285988 | - | NC_015520.1 | Mahella australiensis 50-1 BON |
| 225 | 3576740 | 3577003 | - | NZ_CP027433.1 | Gordonia iterans |
| 226 | 244730 | 245014 | + | NC_013192.1 | Leptotrichia buccalis C-1013-b |
| 227 | 82930 | 83169 | + | NZ_CP014150.1 | Paeniclostridium sordellii |
| 228 | 3317552 | 3317815 | - | NC_022041.1 | Paracoccus aminophilus JCM 7686 |
| 229 | 5702114 | 5702404 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 230 | 8754183 | 8754482 | - | NC_019673.1 | Saccharothrix espanaensis DSM 44229 |
| 231 | 82593 | 82889 | + | NZ_CP031733.1 | Streptococcus chenjunshii |
| 232 | 271361 | 271663 | + | NZ_CP031835.1 | Lactobacillus amylolyticus |
| 233 | 10404795 | 10405094 | - | NZ_CP034550.1 | Saccharothrix syringae |
| 234 | 1292249 | 1292482 | + | NZ_LS483464.1 | Corynebacterium renale |
| 235 | 641523 | 641786 | + | NZ_CP016353.1 | Prauserella marina |
| 236 | 6231278 | 6231556 | - | NZ_AP018920.1 | Pseudonocardia autotrophica |
| 237 | 1362264 | 1362515 | + | NZ_LR134533.1 | Neisseria weaveri |
| 238 | 59478 | 59714 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 239 | 126419 | 126652 | + | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 240 | 2138600 | 2138896 | - | NZ_CP029256.1 | Christensenella minuta |
| 241 | 2185990 | 2186280 | - | NZ_CP059569.1 | Kingella oralis |
| 242 | 1952522 | 1952809 | - | NZ_CP017194.1 | Lactococcus carnosus |
| 243 | 860098 | 860385 | - | NZ_CP023392.1 | Lactococcus raffinolactis |
| 244 | 223290 | 223577 | + | NZ_CP017195.1 | Lactococcus paracarnosus |
| 245 | 4059948 | 4060208 | - | NZ_CP019066.1 | Tsukamurella tyrosinosolvens |
| 246 | 2379832 | 2380131 | - | NZ_CP023434.1 | Suicoccus acidiformans |
| 247 | 5784514 | 5784774 | - | NC_015312.1 | Pseudonocardia dioxanivorans CB1190 |
| 248 | 625248 | 625523 | + | NZ_CP022521.1 | Actinoalloteichus hoggarensis |
| 249 | 647411 | 647686 | + | NZ_CP016076.1 | Actinoalloteichus fjordicus |
| 250 | 2015822 | 2016076 | + | NC_011894.1 | Methylobacterium nodulans ORS 2060 |
| 251 | 384185 | 384418 | - | NZ_CP040818.1 | Paraoceanicella profunda |
| 252 | 5137338 | 5137589 | - | NC_020453.1 | Bradyrhizobium oligotrophicum S58 |
| 253 | 567777 | 568067 | + | NZ_CP059564.1 | Alysiella filiformis |
| 254 | 3859542 | 3859775 | - | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 255 | 405375 | 405608 | + | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP009498.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00009.29 | 0.71 | 182 | 2837.5 | same-strand | Elongation factor Tu GTP binding domain |
| 2 | PF03144.27 | 0.71 | 181 | 2845 | same-strand | Elongation factor Tu domain 2 |
| 3 | PF01926.25 | 0.71 | 180 | 2125 | same-strand | 50S ribosome-binding GTPase |
| 4 | PF03143.19 | 0.68 | 174 | 2025.0 | same-strand | Elongation factor Tu C-terminal domain |
| 5 | PF00338.24 | 0.98 | 250 | 1357.5 | same-strand | Ribosomal protein S10p/S20e |
| 6 | PF00573.24 | 0.99 | 253 | 27 | same-strand | Ribosomal protein L4/L1 family |
| 7 | PF03947.20 | 1.0 | 254 | 30.0 | same-strand | Ribosomal Proteins L2, C-terminal domain |
| 8 | PF00181.25 | 1.0 | 254 | 30.0 | same-strand | Ribosomal Proteins L2, RNA binding domain |
| 9 | PF00203.23 | 1.0 | 254 | 916.0 | same-strand | Ribosomal protein S19 |
| 10 | PF00237.21 | 0.98 | 250 | 1218.0 | same-strand | Ribosomal protein L22p/L17e |
| 11 | PF00189.22 | 1.0 | 254 | 1571.0 | same-strand | Ribosomal protein S3, C-terminal domain |
| 12 | PF07650.19 | 1.0 | 254 | 1571.0 | same-strand | KH domain |
| 13 | PF00252.20 | 0.98 | 250 | 2261.0 | same-strand | Ribosomal protein L16p/L10e |
++ More..