Result : EXP00290
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00290 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 2800455 |
| Right | 2800550 |
| Strand | - |
| Nucleotide Sequence | GTGATTCACCAGGCAAAAAGAAACCCCGAAGACAGGCTTCGGGGTCAAAGACGCGTATTTATTATCATTTTTGCACTACGATTTGCGCATGCTTAA |
| Sequence | VIHQAKRNPEDRLRGQRRVFIIIFALRFAHA |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 27013550 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 31 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2800455 | 2800550 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 2774348 | 2774443 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00581.22 | 1.0 | 2 | 2410.5 | opposite-strand | Rhodanese-like domain |
| 2 | PF00816.23 | 1.0 | 2 | 1959.5 | same-strand | H-NS histone family |
| 3 | PF06610.15 | 1.0 | 2 | 842.0 | opposite-strand | L-alanine exporter |
| 4 | PF09400.12 | 1.0 | 2 | 461.0 | same-strand | Protein of unknown function (DUF2002) |
| 5 | PF05957.15 | 1.0 | 2 | 29.5 | opposite-strand | DUF883 N-terminal domain |
| 6 | PF00462.26 | 1.0 | 2 | 173.0 | opposite-strand | Glutaredoxin |
| 7 | PF07972.13 | 1.0 | 2 | 415.0 | opposite-strand | NrdI Flavodoxin like |
| 8 | PF02867.17 | 1.0 | 2 | 798.0 | opposite-strand | Ribonucleotide reductase, barrel domain |
| 9 | PF08343.12 | 1.0 | 2 | 798.0 | opposite-strand | Ribonucleotide reductase N-terminal |
| 10 | PF00317.23 | 1.0 | 2 | 798.0 | opposite-strand | Ribonucleotide reductase, all-alpha domain |
| 11 | PF00268.23 | 1.0 | 2 | 2952.0 | opposite-strand | Ribonucleotide reductase, small chain |
| 12 | PF00005.29 | 1.0 | 2 | 4265.5 | opposite-strand | ABC transporter |
| 13 | PF00571.30 | 1.0 | 2 | 4265.5 | opposite-strand | CBS domain |
++ More..