Result : EXP00288
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00288 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 705860 |
| Right | 705988 |
| Strand | - |
| Nucleotide Sequence | ATGGGGATGATTGATGAAAAAAAAAGCGGCAGAGAAGATCTCCACCGCTTGTCATTGTTGGATGCGACGCTCAAGCGTCGCATCAGGCATAAAGCAGATTACTTTTTGATTTCATACAGCGGTGTTTGA |
| Sequence | MGMIDEKKSGREDLHRLSLLDATLKRRIRHKADYFLISYSGV |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 27013550 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 42 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 785884 | 786012 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 705860 | 705988 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 3035299 | 3035427 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 645847 | 645975 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13344.8 | 0.67 | 2 | 5534 | same-strand | Haloacid dehalogenase-like hydrolase |
| 2 | PF13242.8 | 0.67 | 2 | 5534 | same-strand | HAD-hyrolase-like |
| 3 | PF00702.28 | 0.67 | 2 | 5534 | same-strand | haloacid dehalogenase-like hydrolase |
| 4 | PF00480.22 | 1.0 | 3 | 4266.0 | same-strand | ROK family |
| 5 | PF13412.8 | 1.0 | 3 | 4266.0 | same-strand | Winged helix-turn-helix DNA-binding |
| 6 | PF01979.22 | 1.0 | 3 | 3109.0 | same-strand | Amidohydrolase family |
| 7 | PF01182.22 | 1.0 | 3 | 2249.0 | same-strand | Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase |
| 8 | PF02378.20 | 1.0 | 3 | -30.0 | opposite-strand | Phosphotransferase system, EIIC |
| 9 | PF00358.22 | 1.0 | 3 | -30.0 | opposite-strand | phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1 |
| 10 | PF00367.22 | 1.0 | 3 | -30.0 | opposite-strand | phosphotransferase system, EIIB |
| 11 | PF00749.23 | 1.0 | 3 | 105.0 | opposite-strand | tRNA synthetases class I (E and Q), catalytic domain |
| 12 | PF03950.20 | 1.0 | 3 | 105.0 | opposite-strand | tRNA synthetases class I (E and Q), anti-codon binding domain |
| 13 | PF13982.8 | 0.67 | 2 | 3802 | opposite-strand | YbfN-like lipoprotein |
| 14 | PF01475.21 | 0.67 | 2 | 4212 | same-strand | Ferric uptake regulator family |
| 15 | PF03573.15 | 0.67 | 2 | 2347.0 | opposite-strand | outer membrane porin, OprD family |
| 16 | PF00258.27 | 0.67 | 2 | 4941.5 | same-strand | Flavodoxin |
++ More..