Protein Information |
Information Type | Description |
---|---|
Protein name | EXP00288 |
NCBI Accession ID | NC_000913.3 |
Organism | Escherichia coli str. K-12 substr. MG1655 |
Left | 705860 |
Right | 705988 |
Strand | - |
Nucleotide Sequence | ATGGGGATGATTGATGAAAAAAAAAGCGGCAGAGAAGATCTCCACCGCTTGTCATTGTTGGATGCGACGCTCAAGCGTCGCATCAGGCATAAAGCAGATTACTTTTTGATTTCATACAGCGGTGTTTGA |
Sequence | MGMIDEKKSGREDLHRLSLLDATLKRRIRHKADYFLISYSGV |
Source of smORF | Ribo-seq |
Function | |
Pubmed ID | 30904393 27013550 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 42 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 785884 | 786012 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
2 | 705860 | 705988 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
3 | 3035299 | 3035427 | + | NZ_CP061527.1 | Shigella dysenteriae |
4 | 645847 | 645975 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13344.8 | 0.67 | 2 | 5534 | same-strand | Haloacid dehalogenase-like hydrolase |
2 | PF13242.8 | 0.67 | 2 | 5534 | same-strand | HAD-hyrolase-like |
3 | PF00702.28 | 0.67 | 2 | 5534 | same-strand | haloacid dehalogenase-like hydrolase |
4 | PF00480.22 | 1.0 | 3 | 4266.0 | same-strand | ROK family |
5 | PF13412.8 | 1.0 | 3 | 4266.0 | same-strand | Winged helix-turn-helix DNA-binding |
6 | PF01979.22 | 1.0 | 3 | 3109.0 | same-strand | Amidohydrolase family |
7 | PF01182.22 | 1.0 | 3 | 2249.0 | same-strand | Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase |
8 | PF02378.20 | 1.0 | 3 | -30.0 | opposite-strand | Phosphotransferase system, EIIC |
9 | PF00358.22 | 1.0 | 3 | -30.0 | opposite-strand | phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1 |
10 | PF00367.22 | 1.0 | 3 | -30.0 | opposite-strand | phosphotransferase system, EIIB |
11 | PF00749.23 | 1.0 | 3 | 105.0 | opposite-strand | tRNA synthetases class I (E and Q), catalytic domain |
12 | PF03950.20 | 1.0 | 3 | 105.0 | opposite-strand | tRNA synthetases class I (E and Q), anti-codon binding domain |
13 | PF13982.8 | 0.67 | 2 | 3802 | opposite-strand | YbfN-like lipoprotein |
14 | PF01475.21 | 0.67 | 2 | 4212 | same-strand | Ferric uptake regulator family |
15 | PF03573.15 | 0.67 | 2 | 2347.0 | opposite-strand | outer membrane porin, OprD family |
16 | PF00258.27 | 0.67 | 2 | 4941.5 | same-strand | Flavodoxin |