Result : B1GZ23
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S16 |
| NCBI Accession ID | AP009510.1 |
| Organism | Endomicrobium trichonymphae |
| Left | 45460 |
| Right | 45714 |
| Strand | - |
| Nucleotide Sequence | ATGGCAGTCCGACTACGTTTGCAAAGAAGGGGCAAACCCAAAAGGCCTTATTACAGAGTTGTAGCGATTGATCAGAGAGCAAAAAGAGACGGAGAGCCTATTGAAATTCTTGGTCAGTATGACCCTATCGCAGAAGATAATAAATTTAAAGTTAATATAGAAAGAATAAATTATTGGTTAGGTATCGGAGCAAAAGCTTCGGAAACTGTAGCTGCATTGATAAAAAAGAACCAAACAGTTGAAATTAAACAATAG |
| Sequence | MAVRLRLQRRGKPKRPYYRVVAIDQRAKRDGEPIEILGQYDPIAEDNKFKVNIERINYWLGIGAKASETVAALIKKNQTVEIKQ |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00368. Profile Description: Ribosomal protein S16. This model describes ribosomal S16 of bacteria and organelles. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 18391199 |
| Domain | CDD:412339 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B1GZ23 |
| ORF Length (Amino Acid) | 84 |
++ More..
| Conservation Analysis |
No. of Species: 36
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1411552 | 1411794 | + | NZ_CP009498.1 | Endomicrobium proavitum |
| 2 | 2619331 | 2619570 | + | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 3 | 1794264 | 1794503 | + | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 4 | 4169161 | 4169421 | + | NZ_CP022203.1 | Corallococcus macrosporus DSM 14697 |
| 5 | 4291725 | 4291985 | - | NZ_CP012109.1 | Myxococcus hansupus |
| 6 | 4130752 | 4131012 | + | NC_008095.1 | Myxococcus xanthus DK 1622 |
| 7 | 731811 | 732053 | + | NZ_CP009302.1 | Berryella intestinalis |
| 8 | 705556 | 705813 | + | NC_015682.1 | Thermodesulfobacterium geofontis OPF15 |
| 9 | 782009 | 782251 | - | NZ_CP036425.1 | Poriferisphaera corsica |
| 10 | 81771 | 82028 | - | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 11 | 3932203 | 3932457 | + | NC_018645.1 | Desulfobacula toluolica Tol2 |
| 12 | 2673388 | 2673633 | - | NC_014624.2 | Eubacterium callanderi |
| 13 | 3103001 | 3103246 | + | NZ_CP019962.1 | Eubacterium limosum |
| 14 | 387623 | 387889 | - | NZ_CP042909.1 | Thermosulfurimonas marina |
| 15 | 1439362 | 1439595 | + | NC_015318.1 | Hippea maritima DSM 10411 |
| 16 | 8369501 | 8369761 | + | NZ_CP022163.1 | Melittangium boletus DSM 14713 |
| 17 | 2234607 | 2234816 | - | NC_016024.1 | Chloracidobacterium thermophilum B |
| 18 | 4299739 | 4299984 | + | NZ_CP029487.1 | Eubacterium maltosivorans |
| 19 | 609096 | 609347 | + | NC_008576.1 | Magnetococcus marinus MC-1 |
| 20 | 639769 | 639996 | - | NZ_CP031611.1 | Campylobacter hepaticus |
| 21 | 5729444 | 5729707 | - | NC_020126.1 | Myxococcus stipitatus DSM 14675 |
| 22 | 981264 | 981542 | + | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 23 | 5695193 | 5695453 | - | NC_017030.1 | Corallococcus coralloides DSM 2259 |
| 24 | 1671543 | 1671773 | + | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
| 25 | 198532 | 198795 | - | NC_007354.1 | Ehrlichia canis str. Jake |
| 26 | 980109 | 980387 | + | NZ_CP014334.1 | Fervidobacterium islandicum |
| 27 | 1767477 | 1767716 | - | NZ_CP054142.1 | Treponema parvum |
| 28 | 2147487 | 2147741 | - | NZ_CP014671.1 | Immundisolibacter cernigliae |
| 29 | 1253411 | 1253653 | + | NZ_LR215050.1 | Acholeplasma hippikon |
| 30 | 2140720 | 2140968 | - | NZ_CP014223.1 | Anaerotignum propionicum DSM 1682 |
| 31 | 1161445 | 1161690 | + | NZ_CP030775.1 | Clostridium butyricum |
| 32 | 1199524 | 1199754 | - | NC_017379.1 | Helicobacter pylori Puno135 |
| 33 | 2083001 | 2083276 | + | NC_020520.1 | Ilumatobacter coccineus YM16-304 |
| 34 | 1104500 | 1104745 | + | NC_015500.1 | Treponema brennaborense DSM 12168 |
| 35 | 3420292 | 3420552 | + | NC_013440.1 | Haliangium ochraceum DSM 14365 |
| 36 | 985556 | 985828 | + | NZ_CP013213.1 | Erysipelothrix larvae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LT907975.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13083.8 | 0.89 | 32 | 19.0 | same-strand | KH domain |
| 2 | PF05239.18 | 0.81 | 29 | 296 | same-strand | PRC-barrel domain |
| 3 | PF01746.23 | 0.97 | 35 | 843 | same-strand | tRNA (Guanine-1)-methyltransferase |
| 4 | PF01245.22 | 0.75 | 27 | 1715 | same-strand | Ribosomal protein L19 |
| 5 | PF00448.24 | 0.61 | 22 | 80.5 | same-strand | SRP54-type protein, GTPase domain |
| 6 | PF02978.21 | 0.61 | 22 | 72.5 | same-strand | Signal peptide binding domain |
| 7 | PF02881.21 | 0.61 | 22 | 80.5 | same-strand | SRP54-type protein, helical bundle domain |
| 8 | PF01782.20 | 0.86 | 31 | 296 | same-strand | RimM N-terminal domain |
++ More..