Result : EXP00275
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00275 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 2418975 |
| Right | 2419130 |
| Strand | - |
| Nucleotide Sequence | ATGAAGAGAACGAAGTCATTGCACAAGCCAGCCGGGAACAAATGCGGGCACAGTGTCTGCGTCATCGTGCAACTTACATCGTCGTGCATGATGGCATGGGCAAAATTCTGGTCCAGCGTCGTACCGAGACAAAAGACTTTTTACCCGGCATGTTAG |
| Sequence | MKRTKSLHKPAGNKCGHSVCVIVQLTSSCMMAWAKFWSSVVPRQKTFYPAC |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 27013550 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 51 |
++ More..
| Conservation Analysis |
No. of Species: 11
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2418975 | 2419130 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 2427087 | 2427242 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 1307006 | 1307161 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 3145280 | 3145435 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 5 | 2962647 | 2962802 | - | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 465415 | 465570 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 7 | 4642799 | 4642954 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 8 | 2860875 | 2861030 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 9 | 2195387 | 2195542 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 10 | 2458757 | 2458912 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 11 | 429600 | 429755 | - | NZ_CP053416.1 | Salmonella bongori |
| 12 | 1910126 | 1910281 | - | NC_010554.1 | Proteus mirabilis HI4320 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR134340.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00293.30 | 1.0 | 11 | -155.0 | same-strand | NUDIX domain |
| 2 | PF12850.9 | 0.91 | 10 | 105 | same-strand | Calcineurin-like phosphoesterase superfamily domain |
| 3 | PF14834.8 | 0.91 | 10 | 712 | same-strand | Glutathione S-transferase, C-terminal domain |
| 4 | PF02798.22 | 1.0 | 11 | 873.0 | both-strands | Glutathione S-transferase, N-terminal domain |
| 5 | PF13417.8 | 1.0 | 11 | 873.0 | both-strands | Glutathione S-transferase, N-terminal domain |
| 6 | PF13409.8 | 1.0 | 11 | 873.0 | both-strands | Glutathione S-transferase, N-terminal domain |
| 7 | PF13410.8 | 0.91 | 10 | 1491 | opposite-strand | Glutathione S-transferase, C-terminal domain |
| 8 | PF02152.20 | 0.64 | 7 | 2195.0 | opposite-strand | Dihydroneopterin aldolase |
| 9 | PF01370.23 | 0.82 | 9 | 2578.0 | opposite-strand | NAD dependent epimerase/dehydratase family |
| 10 | PF08338.13 | 0.82 | 9 | 2578.0 | opposite-strand | Domain of unknown function (DUF1731) |
| 11 | PF03611.16 | 0.64 | 7 | 2445 | same-strand | PTS system sugar-specific permease component |
| 12 | PF02302.19 | 0.64 | 7 | 2152 | same-strand | PTS system, Lactose/Cellobiose specific IIB subunit |
| 13 | PF00359.24 | 0.64 | 7 | 1627 | same-strand | Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2 |
| 14 | PF13377.8 | 0.64 | 7 | 356 | opposite-strand | Periplasmic binding protein-like domain |
| 15 | PF00356.23 | 0.64 | 7 | 356 | opposite-strand | Bacterial regulatory proteins, lacI family |
| 16 | PF00532.23 | 0.64 | 7 | 356 | opposite-strand | Periplasmic binding proteins and sugar binding domain of LacI family |
++ More..