Result : EXP00273
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00273 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 829720 |
| Right | 829824 |
| Strand | - |
| Nucleotide Sequence | GTGTTGGGGGGCGCGTTGAATCGCTGGCGGTGGACGAAGGTGATGCTATCAAAGCGGGCCAGGTGCTGGGCGAACTGGATCACAAGCCGTATGAGATTGCCCTGA |
| Sequence | VLGGALNRWRWTKVMLSKRARCWANWITSRMRLP |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 27013550 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 34 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 952088 | 952192 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 829720 | 829824 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 772547 | 772651 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 2858373 | 2858477 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 5 | 1314763 | 1314852 | + | NZ_CP057657.1 | Escherichia fergusonii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF11076.10 | 1.0 | 4 | 4680 | opposite-strand | Putative inner membrane protein YbhQ |
| 2 | PF12698.9 | 1.0 | 4 | 3040.0 | same-strand | ABC-2 family transporter protein |
| 3 | PF12679.9 | 1.0 | 4 | 3040.0 | same-strand | ABC-2 family transporter protein |
| 4 | PF00005.29 | 1.0 | 4 | 739 | same-strand | ABC transporter |
| 5 | PF16576.7 | 1.0 | 4 | -104 | same-strand | Barrel-sandwich domain of CusB or HlyD membrane-fusion |
| 6 | PF13437.8 | 1.0 | 4 | -104 | same-strand | HlyD family secretion protein |
| 7 | PF13533.8 | 1.0 | 4 | -104 | same-strand | Biotin-lipoyl like |
| 8 | PF09209.13 | 1.0 | 4 | 148 | same-strand | HTH-type transcriptional dual regulator CecR, C-terminal domain |
| 9 | PF00440.25 | 1.0 | 4 | 148 | same-strand | Bacterial regulatory proteins, tetR family |
| 10 | PF00270.31 | 1.0 | 4 | 1048 | opposite-strand | DEAD/DEAH box helicase |
| 11 | PF00271.33 | 1.0 | 4 | 1048 | opposite-strand | Helicase conserved C-terminal domain |
| 12 | PF04851.17 | 1.0 | 4 | 1063 | opposite-strand | Type III restriction enzyme, res subunit |
| 13 | PF13245.8 | 1.0 | 4 | 1048 | opposite-strand | AAA domain |
| 14 | PF13307.8 | 0.75 | 3 | 3010.0 | opposite-strand | Helicase C-terminal domain |
| 15 | PF02885.19 | 0.75 | 3 | 5323.0 | opposite-strand | Glycosyl transferase family, helical bundle domain |
++ More..