Result : B1GYK8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0235 protein TGRD_618 |
| NCBI Accession ID | AP009510.1 |
| Organism | Endomicrobium trichonymphae |
| Left | 906647 |
| Right | 906910 |
| Strand | - |
| Nucleotide Sequence | ATGATTATTAAAGTCAGAGTGATACCTAACTCAAAAAGAAATGAGGTCGTAAGCAGAGTGGGTTCTATTTTAAGGGTAAAAATCACGGCACCTGCGATTGAGGGCAGGGCAAATGAAGAGCTATGCGATTTTTTATCAGATTTTTTTGACGTAAAAAGATCGATGATTTTTCTGAGAAAAGGCGAAAGAGGCAGAGAAAAAACTATTGAAGTGTTGGGACGTTTGGAAGAAGAACTTAATGAAGTTTTGGATACGATACCGTAA |
| Sequence | MIIKVRVIPNSKRNEVVSRVGSILRVKITAPAIEGRANEELCDFLSDFFDVKRSMIFLRKGERGREKTIEVLGRLEEELNEVLDTIP |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00811. Profile Description: Uncharacterized ACR, YggU family COG1872. hypothetical protein; Validated |
| Pubmed ID | 18391199 |
| Domain | CDD:412584 |
| Functional Category | Others |
| Uniprot ID | B1GYK8 |
| ORF Length (Amino Acid) | 87 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 210039 | 210302 | + | NZ_CP009498.1 | Endomicrobium proavitum |
| 2 | 867040 | 867303 | + | NC_010644.1 | Elusimicrobium minutum Pei191 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP009498.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01168.22 | 1.0 | 2 | 442.0 | same-strand | Alanine racemase, N-terminal domain |
++ More..