Result : EXP00272
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00272 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 2743541 |
| Right | 2743636 |
| Strand | - |
| Nucleotide Sequence | GTGCTTTATCATATCGATATATCCTTGTTATCTCACCAGCTTTTCGGCACGCTGGTGTTTGGCCTGATACATATTGTGATCGGCAAGCTCTTGTAA |
| Sequence | VLYHIDISLLSHQLFGTLVFGLIHIVIGKLL |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 27013550 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 31 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2743541 | 2743636 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 2742191 | 2742286 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 1034133 | 1034228 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 3463793 | 3463888 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 5 | 2712640 | 2712735 | - | NZ_AP014857.1 | Escherichia albertii |
| 6 | 3263817 | 3263912 | - | NZ_LR134340.1 | Escherichia marmotae |
| 7 | 1435001 | 1435084 | - | NZ_CP033744.1 | Citrobacter freundii |
| 8 | 4632842 | 4632925 | + | NZ_CP038469.1 | Citrobacter tructae |
| 9 | 3673150 | 3673233 | + | NZ_CP044098.1 | Citrobacter portucalensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02153.19 | 0.62 | 5 | 3484.0 | same-strand | Prephenate dehydrogenase |
| 2 | PF01817.23 | 0.62 | 5 | 3484.0 | same-strand | Chorismate mutase type II |
| 3 | PF00793.22 | 0.88 | 7 | 2392.0 | same-strand | DAHP synthetase I family |
| 4 | PF10973.10 | 0.88 | 7 | 1817.5 | opposite-strand | Protein of unknown function (DUF2799) |
| 5 | PF13689.8 | 0.88 | 7 | 1148.0 | opposite-strand | YfiR/HmsC-like |
| 6 | PF00990.23 | 0.88 | 7 | -68.0 | opposite-strand | Diguanylate cyclase, GGDEF domain |
| 7 | PF17152.6 | 0.75 | 6 | -68 | opposite-strand | Periplasmic sensor domain |
| 8 | PF00691.22 | 1.0 | 8 | -11 | opposite-strand | OmpA family |
| 9 | PF01245.22 | 1.0 | 8 | 548 | same-strand | Ribosomal protein L19 |
| 10 | PF01746.23 | 1.0 | 8 | 937 | same-strand | tRNA (Guanine-1)-methyltransferase |
| 11 | PF01782.20 | 0.88 | 7 | 1735.0 | same-strand | RimM N-terminal domain |
| 12 | PF05239.18 | 0.88 | 7 | 1735.0 | same-strand | PRC-barrel domain |
| 13 | PF00886.21 | 0.88 | 7 | 2302.0 | same-strand | Ribosomal protein S16 |
++ More..