Result : EXP00265
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00265 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 966339 |
| Right | 966449 |
| Strand | - |
| Nucleotide Sequence | TTGATATCCTTGCAGTTGATAGCGATGCTTAACTTTGTTAGAGGGCAGTCGCCATGCGTTATAGCGCGATGCCGATGCGAGTGCCACTTTTCCATTCACTCGCTGAATTAA |
| Sequence | LISLQLIAMLNFVRGQSPCVIARCRCECHFSIHSLN |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 27013550 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 36 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 966339 | 966449 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 950124 | 950234 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 1095982 | 1096077 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 1466602 | 1466697 | - | NZ_CP061527.1 | Shigella dysenteriae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01435.20 | 0.67 | 2 | 5310 | opposite-strand | Peptidase family M48 |
| 2 | PF02224.20 | 0.67 | 2 | 4454 | opposite-strand | Cytidylate kinase |
| 3 | PF13189.8 | 0.67 | 2 | 4454 | opposite-strand | Cytidylate kinase-like family |
| 4 | PF00575.25 | 1.0 | 3 | 2670.0 | opposite-strand | S1 RNA binding domain |
| 5 | PF00216.23 | 1.0 | 3 | 2226.0 | opposite-strand | Bacterial DNA-binding protein |
| 6 | PF03772.18 | 1.0 | 3 | -95.0 | opposite-strand | Competence protein |
| 7 | PF00753.29 | 1.0 | 3 | -102.5 | opposite-strand | Metallo-beta-lactamase superfamily |
| 8 | PF00664.25 | 1.0 | 3 | 179.5 | opposite-strand | ABC transporter transmembrane region |
| 9 | PF00005.29 | 1.0 | 3 | 179.5 | opposite-strand | ABC transporter |
| 10 | PF02463.21 | 1.0 | 3 | 179.5 | opposite-strand | RecF/RecN/SMC N terminal domain |
| 11 | PF00270.31 | 1.0 | 3 | 179.5 | opposite-strand | DEAD/DEAH box helicase |
| 12 | PF13191.8 | 1.0 | 3 | 179.5 | opposite-strand | AAA ATPase domain |
| 13 | PF02606.16 | 1.0 | 3 | 1924.5 | opposite-strand | Tetraacyldisaccharide-1-P 4'-kinase |
| 14 | PF06224.14 | 1.0 | 3 | 2947.5 | opposite-strand | Winged helix DNA-binding domain |
| 15 | PF03966.18 | 1.0 | 3 | 4231.5 | opposite-strand | Trm112p-like protein |
| 16 | PF02348.21 | 1.0 | 3 | 4410.5 | opposite-strand | Cytidylyltransferase |
++ More..