Protein Information |
Information Type | Description |
---|---|
Protein name | 50S ribosomal protein L32 |
NCBI Accession ID | CP000942.1 |
Organism | Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) |
Left | 378939 |
Right | 379112 |
Strand | + |
Nucleotide Sequence | ATGGCTGTACAACAAAGAAGAGTAAGTAAATCAAGAAAAGGAATGCGTCGTAGTCACGATCACCTTACAATTTCTAATACAGTAGCATGTAATGAATGTGGTAAAGCATTACTACCTCATAGAGCTTGTCGTGATTGCAAAACTTACAGAAGTATTAAGTTATCAATCAAATAA |
Sequence | MAVQQRRVSKSRKGMRRSHDHLTISNTVACNECGKALLPHRACRDCKTYRSIKLSIK |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl09115. Profile Description: Ribosomal L32p protein family. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
Pubmed ID | |
Domain | CDD:415589 |
Functional Category | Ribosomal_protein |
Uniprot ID | B1AIX2 |
ORF Length (Amino Acid) | 57 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 378939 | 379112 | + | NC_010503.1 | Ureaplasma parvum serovar 3 str. ATCC 27815 |
2 | 377904 | 378077 | + | NC_011374.1 | Ureaplasma urealyticum serovar 10 str. ATCC 33699 |
3 | 145981 | 146160 | + | NZ_LR215023.1 | Mycoplasma iowae |
4 | 3034510 | 3034689 | - | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
5 | 616419 | 616601 | - | NZ_CP026538.1 | Desulfovibrio carbinolicus |
6 | 4516654 | 4516836 | + | NC_012796.1 | Desulfovibrio magneticus RS-1 |
7 | 1845472 | 1845651 | - | NC_016803.1 | Pseudodesulfovibrio mercurii |
8 | 3629802 | 3629984 | + | NZ_CP045504.1 | Desulfovibrio sulfodismutans DSM 3696 |
9 | 790989 | 791171 | + | NZ_CP045508.1 | Desulfolutivibrio sulfoxidireducens |
10 | 1816550 | 1816729 | + | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
11 | 720351 | 720530 | - | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
12 | 1303788 | 1303967 | - | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
13 | 1232950 | 1233129 | - | NC_004432.1 | Mycoplasma penetrans HF-2 |
14 | 1775742 | 1775924 | + | NZ_CP009788.1 | Geobacter pickeringii |
15 | 239050 | 239232 | + | NZ_CP042909.1 | Thermosulfurimonas marina |
16 | 1798827 | 1799009 | + | NC_007517.1 | Geobacter metallireducens GS-15 |
17 | 1751670 | 1751852 | + | NC_002939.5 | Geobacter sulfurreducens PCA |
18 | 2065775 | 2065960 | - | NC_010814.1 | Geobacter lovleyi SZ |
19 | 2763060 | 2763239 | + | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
20 | 2873184 | 2873366 | + | NC_011979.1 | Geobacter daltonii FRC-32 |
21 | 1873945 | 1874130 | + | NC_008609.1 | Pelobacter propionicus DSM 2379 |
22 | 1475489 | 1475668 | + | NZ_CP039543.1 | Desulfovibrio marinus |
23 | 2175466 | 2175648 | + | NC_009483.1 | Geobacter uraniireducens Rf4 |
24 | 1693545 | 1693721 | + | NZ_AP017312.1 | Aneurinibacillus soli |
25 | 1393664 | 1393840 | + | NC_013205.1 | Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 |
26 | 2660163 | 2660336 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
27 | 457946 | 458116 | - | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
28 | 456012 | 456191 | - | NC_006055.1 | Mesoplasma florum L1 |
29 | 503440 | 503619 | - | NZ_CP024964.1 | Entomoplasma melaleucae |
30 | 512482 | 512661 | - | NZ_CP024969.1 | Mesoplasma tabanidae |
31 | 472750 | 472929 | - | NZ_CP024411.1 | Mesoplasma entomophilum |
32 | 501574 | 501753 | - | NZ_CP023173.1 | Mesoplasma chauliocola |
33 | 460497 | 460670 | + | NC_000908.2 | Mycoplasma genitalium G37 |
34 | 655565 | 655738 | + | NZ_CP010546.1 | Mycoplasma pneumoniae FH |
35 | 2371068 | 2371250 | + | NZ_AP017378.1 | Desulfovibrio ferrophilus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13561.8 | 0.63 | 22 | 2409.0 | same-strand | Enoyl-(Acyl carrier protein) reductase |
2 | PF00106.27 | 0.63 | 22 | 2409.0 | same-strand | short chain dehydrogenase |
3 | PF08659.12 | 0.63 | 22 | 2409.0 | same-strand | KR domain |
4 | PF08541.12 | 0.6 | 21 | 1105 | same-strand | 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal |
5 | PF08545.12 | 0.6 | 21 | 1105 | same-strand | 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III |
6 | PF02504.17 | 0.66 | 23 | -7 | same-strand | Fatty acid synthesis protein |
7 | PF02620.19 | 0.66 | 23 | 52 | same-strand | Large ribosomal RNA subunit accumulation protein YceD |