Result : EXP00259
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00259 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 1906361 |
| Right | 1906483 |
| Strand | - |
| Nucleotide Sequence | ATGAAGTACATCTTCATGCACCTCATGCAGAACAACTGGAAGGTTTTACATTACAGCAGAGTGCGGAGTTGTGTTATCCGATGCGTCTTCGCGGTGATGAAGCCGTCGCATTATTGCAGATGA |
| Sequence | MKYIFMHLMQNNWKVLHYSRVRSCVIRCVFAVMKPSHYCR |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 27013550 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 40 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1906361 | 1906483 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 1443037 | 1443159 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 1812645 | 1812767 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 2508328 | 2508450 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 5 | 1839274 | 1839396 | - | NZ_AP014857.1 | Escherichia albertii |
| 6 | 1943668 | 1943766 | + | NZ_LR134340.1 | Escherichia marmotae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03609.16 | 0.8 | 4 | 2473.5 | opposite-strand | PTS system sorbose-specific iic component |
| 2 | PF03613.16 | 0.8 | 4 | 1615 | opposite-strand | PTS system mannose/fructose/sorbose family IID component |
| 3 | PF06173.14 | 1.0 | 5 | 1102.5 | opposite-strand | Protein of unknown function (DUF986) |
| 4 | PF02659.17 | 1.0 | 5 | 107.0 | opposite-strand | Putative manganese efflux pump |
| 5 | PF13649.8 | 1.0 | 5 | -122.0 | same-strand | Methyltransferase domain |
| 6 | PF08241.14 | 1.0 | 5 | -122.0 | same-strand | Methyltransferase domain |
| 7 | PF00313.24 | 1.0 | 5 | 743.0 | same-strand | 'Cold-shock' DNA-binding domain |
| 8 | PF13974.8 | 0.8 | 4 | 1778 | same-strand | YebO-like protein |
| 9 | PF13996.8 | 0.8 | 4 | 2442 | opposite-strand | YobH-like protein |
| 10 | PF01614.20 | 0.8 | 4 | 2825 | same-strand | Bacterial transcriptional regulator |
| 11 | PF09339.12 | 0.8 | 4 | 2825 | same-strand | IclR helix-turn-helix domain |
| 12 | PF13412.8 | 0.8 | 4 | 2825 | same-strand | Winged helix-turn-helix DNA-binding |
++ More..