Result : EXP00257
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00257 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 391339 |
| Right | 391515 |
| Strand | - |
| Nucleotide Sequence | ATGGAACGACCTGTAGTATCCCATTCAGAACCGTTATTCAACGCTACGTTAAATACACCGCTCTGGAAGACCTTGTCATCAACAACACGTTTCCAGTCATTGTTTTCATATGTTGCATCAGGAGTAAGGCTGTTTGTAGCAACATCATACATTGCTGACGTTTCAGCAACGTTATAA |
| Sequence | MERPVVSHSEPLFNATLNTPLWKTLSSTTRFQSLFSYVASGVRLFVATSYIADVSATL |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 27013550 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 58 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 391339 | 391515 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 426284 | 426427 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 3 | 3883274 | 3883462 | - | NZ_CP033744.1 | Citrobacter freundii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP033744.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00005.29 | 0.67 | 2 | 4341.5 | opposite-strand | ABC transporter |
| 2 | PF13401.8 | 0.67 | 2 | 4341.5 | opposite-strand | AAA domain |
| 3 | PF00528.24 | 0.67 | 2 | 3516.0 | opposite-strand | Binding-protein-dependent transport system inner membrane component |
| 4 | PF02668.18 | 0.67 | 2 | 2669.5 | opposite-strand | Taurine catabolism dioxygenase TauD, TfdA family |
| 5 | PF00490.23 | 1.0 | 3 | 1612 | same-strand | Delta-aminolevulinic acid dehydratase |
| 6 | PF03797.21 | 1.0 | 3 | -143 | opposite-strand | Autotransporter beta-domain |
| 7 | PF15977.7 | 1.0 | 3 | 1761 | opposite-strand | Winged helix-turn-helix DNA binding |
| 8 | PF00144.26 | 1.0 | 3 | 2429 | same-strand | Beta-lactamase |
| 9 | PF05992.14 | 0.67 | 2 | 3904.0 | opposite-strand | SbmA/BacA-like family |
| 10 | PF07759.14 | 0.67 | 2 | 5139.5 | opposite-strand | Protein of unknown function (DUF1615) |
| 11 | PF10954.10 | 0.67 | 2 | 6249.5 | same-strand | Protein of unknown function (DUF2755) |
++ More..