Result : EXP00243
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00243 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 4609150 |
| Right | 4609320 |
| Strand | - |
| Nucleotide Sequence | GTGTTTACACAGGAGCTGCTCCAGTTCGTGCAACGAAGAAACGGTCCAGGTGGGCGCGATGCCTTCTGGTTGCTCGCGATGGTGTGCATTCAGCCAGCAGGTCGCAAGCCCGGCGTTGATGCCACCGAGAATATCGGACTCGGCAGTGTCGCCAACCATCAGCACGCGTGA |
| Sequence | VFTQELLQFVQRRNGPGGRDAFWLLAMVCIQPAGRKPGVDATENIGLGSVANHQHA |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 27013550 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 56 |
++ More..
| Conservation Analysis |
No. of Species: 11
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4609150 | 4609320 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 5467323 | 5467493 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 3 | 3646448 | 3646618 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 4576021 | 4576191 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 5 | 3501218 | 3501388 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 6 | 4626272 | 4626442 | - | NZ_AP014857.1 | Escherichia albertii |
| 7 | 626538 | 626675 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 8 | 3991968 | 3992129 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 9 | 1879886 | 1880023 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 10 | 646021 | 646158 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 11 | 4145287 | 4145457 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 12 | 2389789 | 2389986 | + | NZ_CP045300.1 | Kosakonia arachidis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP057657.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07256.14 | 1.0 | 11 | 3056.5 | opposite-strand | Protein of unknown function (DUF1435) |
| 2 | PF05175.16 | 1.0 | 11 | 1450.0 | same-strand | Methyltransferase small domain |
| 3 | PF08468.13 | 1.0 | 11 | 1450.0 | same-strand | Methyltransferase small domain N-terminal |
| 4 | PF13649.8 | 1.0 | 11 | 1450.0 | same-strand | Methyltransferase domain |
| 5 | PF08242.14 | 1.0 | 11 | 1450.0 | same-strand | Methyltransferase domain |
| 6 | PF08241.14 | 1.0 | 11 | 1450.0 | same-strand | Methyltransferase domain |
| 7 | PF03603.15 | 1.0 | 11 | 934.0 | opposite-strand | DNA polymerase III psi subunit |
| 8 | PF00583.27 | 0.73 | 8 | 519 | opposite-strand | Acetyltransferase (GNAT) family |
| 9 | PF13508.9 | 0.82 | 9 | 519.0 | opposite-strand | Acetyltransferase (GNAT) domain |
| 10 | PF00702.28 | 0.91 | 10 | -170 | opposite-strand | haloacid dehalogenase-like hydrolase |
| 11 | PF13242.8 | 0.91 | 10 | -170 | opposite-strand | HAD-hyrolase-like |
| 12 | PF12710.9 | 0.73 | 8 | -170 | opposite-strand | haloacid dehalogenase-like hydrolase |
| 13 | PF16658.7 | 1.0 | 11 | 94.0 | opposite-strand | Class II release factor RF3, C-terminal domain |
| 14 | PF00009.29 | 1.0 | 11 | 94.0 | opposite-strand | Elongation factor Tu GTP binding domain |
| 15 | PF03144.27 | 1.0 | 11 | 94.0 | opposite-strand | Elongation factor Tu domain 2 |
| 16 | PF01926.25 | 1.0 | 11 | 94.0 | opposite-strand | 50S ribosome-binding GTPase |
| 17 | PF14492.8 | 1.0 | 11 | 94.0 | opposite-strand | Elongation Factor G, domain III |
| 18 | PF04972.19 | 1.0 | 11 | 2073.0 | opposite-strand | BON domain |
| 19 | PF07043.15 | 1.0 | 11 | 2807.5 | opposite-strand | Protein of unknown function (DUF1328) |
| 20 | PF19890.1 | 1.0 | 11 | 3089.5 | opposite-strand | Domain of unknown function (DUF6363) |
| 21 | PF01734.24 | 1.0 | 11 | 3089.5 | opposite-strand | Patatin-like phospholipase |
| 22 | PF13420.9 | 0.64 | 7 | 532 | opposite-strand | Acetyltransferase (GNAT) domain |
++ More..