Protein Information |
Information Type | Description |
---|---|
Protein name | EXP00243 |
NCBI Accession ID | NC_000913.3 |
Organism | Escherichia coli str. K-12 substr. MG1655 |
Left | 4609150 |
Right | 4609320 |
Strand | - |
Nucleotide Sequence | GTGTTTACACAGGAGCTGCTCCAGTTCGTGCAACGAAGAAACGGTCCAGGTGGGCGCGATGCCTTCTGGTTGCTCGCGATGGTGTGCATTCAGCCAGCAGGTCGCAAGCCCGGCGTTGATGCCACCGAGAATATCGGACTCGGCAGTGTCGCCAACCATCAGCACGCGTGA |
Sequence | VFTQELLQFVQRRNGPGGRDAFWLLAMVCIQPAGRKPGVDATENIGLGSVANHQHA |
Source of smORF | Ribo-seq |
Function | |
Pubmed ID | 30904393 27013550 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 56 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 4609150 | 4609320 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
2 | 5467323 | 5467493 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
3 | 3646448 | 3646618 | + | NZ_CP061527.1 | Shigella dysenteriae |
4 | 4576021 | 4576191 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
5 | 3501218 | 3501388 | - | NZ_CP057657.1 | Escherichia fergusonii |
6 | 4626272 | 4626442 | - | NZ_AP014857.1 | Escherichia albertii |
7 | 626538 | 626675 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
8 | 3991968 | 3992129 | + | NZ_CP035129.1 | Kosakonia cowanii |
9 | 1879886 | 1880023 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
10 | 646021 | 646158 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
11 | 4145287 | 4145457 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
12 | 2389789 | 2389986 | + | NZ_CP045300.1 | Kosakonia arachidis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF07256.14 | 1.0 | 11 | 3056.5 | opposite-strand | Protein of unknown function (DUF1435) |
2 | PF05175.16 | 1.0 | 11 | 1450.0 | same-strand | Methyltransferase small domain |
3 | PF08468.13 | 1.0 | 11 | 1450.0 | same-strand | Methyltransferase small domain N-terminal |
4 | PF13649.8 | 1.0 | 11 | 1450.0 | same-strand | Methyltransferase domain |
5 | PF08242.14 | 1.0 | 11 | 1450.0 | same-strand | Methyltransferase domain |
6 | PF08241.14 | 1.0 | 11 | 1450.0 | same-strand | Methyltransferase domain |
7 | PF03603.15 | 1.0 | 11 | 934.0 | opposite-strand | DNA polymerase III psi subunit |
8 | PF00583.27 | 0.73 | 8 | 519 | opposite-strand | Acetyltransferase (GNAT) family |
9 | PF13508.9 | 0.82 | 9 | 519.0 | opposite-strand | Acetyltransferase (GNAT) domain |
10 | PF00702.28 | 0.91 | 10 | -170 | opposite-strand | haloacid dehalogenase-like hydrolase |
11 | PF13242.8 | 0.91 | 10 | -170 | opposite-strand | HAD-hyrolase-like |
12 | PF12710.9 | 0.73 | 8 | -170 | opposite-strand | haloacid dehalogenase-like hydrolase |
13 | PF16658.7 | 1.0 | 11 | 94.0 | opposite-strand | Class II release factor RF3, C-terminal domain |
14 | PF00009.29 | 1.0 | 11 | 94.0 | opposite-strand | Elongation factor Tu GTP binding domain |
15 | PF03144.27 | 1.0 | 11 | 94.0 | opposite-strand | Elongation factor Tu domain 2 |
16 | PF01926.25 | 1.0 | 11 | 94.0 | opposite-strand | 50S ribosome-binding GTPase |
17 | PF14492.8 | 1.0 | 11 | 94.0 | opposite-strand | Elongation Factor G, domain III |
18 | PF04972.19 | 1.0 | 11 | 2073.0 | opposite-strand | BON domain |
19 | PF07043.15 | 1.0 | 11 | 2807.5 | opposite-strand | Protein of unknown function (DUF1328) |
20 | PF19890.1 | 1.0 | 11 | 3089.5 | opposite-strand | Domain of unknown function (DUF6363) |
21 | PF01734.24 | 1.0 | 11 | 3089.5 | opposite-strand | Patatin-like phospholipase |
22 | PF13420.9 | 0.64 | 7 | 532 | opposite-strand | Acetyltransferase (GNAT) domain |