Protein Information |
Information Type | Description |
---|---|
Protein name | EXP00239 |
NCBI Accession ID | NC_000913.3 |
Organism | Escherichia coli str. K-12 substr. MG1655 |
Left | 3328097 |
Right | 3328219 |
Strand | - |
Nucleotide Sequence | ATGTTGATGTATTGTAAAGAAAGGAAAAAGGCCGCTATGCGGCCTTTTATCAACGAACAGAGCGTGGCATTTTGCTCTCCTGCCTGCGGAAAACCCCTCGTTTTACACAGCAAATGTGTGTAA |
Sequence | MLMYCKERKKAAMRPFINEQSVAFCSPACGKPLVLHSKCV |
Source of smORF | Ribo-seq |
Function | |
Pubmed ID | 30904393 27013550 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 40 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3328097 | 3328219 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
2 | 2252908 | 2253030 | - | NZ_CP057657.1 | Escherichia fergusonii |
3 | 488495 | 488617 | + | NZ_CP061527.1 | Shigella dysenteriae |
4 | 3320279 | 3320401 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
5 | 3311668 | 3311790 | - | NZ_AP014857.1 | Escherichia albertii |
6 | 3833397 | 3833519 | - | NZ_LR134340.1 | Escherichia marmotae |
7 | 4231472 | 4231600 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
8 | 327608 | 327709 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02878.18 | 1.0 | 8 | 4027.0 | same-strand | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I |
2 | PF02880.18 | 1.0 | 8 | 4027.0 | same-strand | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III |
3 | PF02879.18 | 1.0 | 8 | 4027.0 | same-strand | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II |
4 | PF00408.22 | 1.0 | 8 | 4027.0 | same-strand | Phosphoglucomutase/phosphomannomutase, C-terminal domain |
5 | PF00809.24 | 1.0 | 8 | 3186.0 | same-strand | Pterin binding enzyme |
6 | PF01434.20 | 1.0 | 8 | 1153.0 | same-strand | Peptidase family M41 |
7 | PF00004.31 | 1.0 | 8 | 1153.0 | same-strand | ATPase family associated with various cellular activities (AAA) |
8 | PF06480.17 | 1.0 | 8 | 1153.0 | same-strand | FtsH Extracellular |
9 | PF17862.3 | 1.0 | 8 | 1153.0 | same-strand | AAA+ lid domain |
10 | PF07728.16 | 1.0 | 8 | 1153.0 | same-strand | AAA domain (dynein-related subfamily) |
11 | PF01728.21 | 1.0 | 8 | 433.0 | same-strand | FtsJ-like methyltransferase |
12 | PF01985.23 | 1.0 | 8 | 14.0 | opposite-strand | CRS1 / YhbY (CRM) domain |
13 | PF03449.17 | 1.0 | 8 | 20.0 | same-strand | Transcription elongation factor, N-terminal |
14 | PF01272.21 | 1.0 | 8 | 20.0 | same-strand | Transcription elongation factor, GreA/GreB, C-term |
15 | PF02113.17 | 1.0 | 8 | 744.0 | opposite-strand | D-Ala-D-Ala carboxypeptidase 3 (S13) family |
16 | PF01018.24 | 1.0 | 8 | 2287.5 | same-strand | GTP1/OBG |
17 | PF01926.25 | 1.0 | 8 | 2287.5 | same-strand | 50S ribosome-binding GTPase |
18 | PF00892.22 | 1.0 | 8 | 3475.5 | same-strand | EamA-like transporter family |
19 | PF01016.21 | 1.0 | 8 | 4537.0 | same-strand | Ribosomal L27 protein |