Result : EXP00237
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00237 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 4085847 |
| Right | 4085939 |
| Strand | - |
| Nucleotide Sequence | TTGAGCCAATTCTGGACCTTTGCGGCCCCTTCCGCAAAGAAAAATAACTCCCACTCCCTGCACACGCAGCAAGCGAATGTAAATGGGACGTGA |
| Sequence | LSQFWTFAAPSAKKNNSHSLHTQQANVNGT |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 27013550 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 30 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4884610 | 4884702 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 4085847 | 4085939 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 4101256 | 4101348 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 3019727 | 3019819 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 5 | 9998 | 10090 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 6 | 4253735 | 4253827 | + | NZ_LR134340.1 | Escherichia marmotae |
| 7 | 4059934 | 4060026 | - | NZ_AP014857.1 | Escherichia albertii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04216.14 | 1.0 | 6 | 4619 | same-strand | Protein involved in formate dehydrogenase formation |
| 2 | PF01292.22 | 1.0 | 6 | 3987 | same-strand | Prokaryotic cytochrome b561 |
| 3 | PF13247.8 | 1.0 | 6 | 3088 | same-strand | 4Fe-4S dicluster domain |
| 4 | PF09163.13 | 1.0 | 6 | 3088 | same-strand | Formate dehydrogenase N, transmembrane |
| 5 | PF12838.9 | 1.0 | 6 | 3088 | same-strand | 4Fe-4S dicluster domain |
| 6 | PF13187.8 | 1.0 | 6 | 3088 | same-strand | 4Fe-4S dicluster domain |
| 7 | PF13237.8 | 1.0 | 6 | 3088 | same-strand | 4Fe-4S dicluster domain |
| 8 | PF12837.9 | 1.0 | 6 | 3088 | same-strand | 4Fe-4S binding domain |
| 9 | PF14697.8 | 1.0 | 6 | 3088 | same-strand | 4Fe-4S dicluster domain |
| 10 | PF01568.23 | 1.0 | 6 | 661 | same-strand | Molydopterin dinucleotide binding domain |
| 11 | PF04879.18 | 1.0 | 6 | 25 | same-strand | Molybdopterin oxidoreductase Fe4S4 domain |
| 12 | PF02634.17 | 1.0 | 6 | 77 | opposite-strand | FdhD/NarQ family |
| 13 | PF12889.9 | 0.67 | 4 | 1064 | opposite-strand | Protein of unknown function (DUF3829) |
++ More..