Result : B1AIJ1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S15 |
| NCBI Accession ID | CP000942.1 |
| Organism | Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) |
| Left | 249400 |
| Right | 249669 |
| Strand | - |
| Nucleotide Sequence | ATGGCAGTAAGCAAACAACAAAAACATGATTTAACAGTTAAATTTGGTGGTTCTGCATCAAATACAGGAAAAACAGAAGTTCAAGTAGCAATCTTAAGTGCTGAAATTGATTCATTAACAACACATATGATTGAAAATAAAAAAGATAAAGCTTCAAAGCGTGGTTTATACAAAAAAGTAGCTCAACGTAAAAAATTATTATCATACTTACAACGTGTTGATATTGAACGTTATCGTGCTTTAATTAAAGAATTAAACTTAAGAGGATAA |
| Sequence | MAVSKQQKHDLTVKFGGSASNTGKTEVQVAILSAEIDSLTTHMIENKKDKASKRGLYKKVAQRKKLLSYLQRVDIERYRALIKELNLRG |
| Source of smORF | Swiss-Prot |
| Function | One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it helps nucleate assembly of the platform of the 30S subunit by binding and bridging several RNA helices of the 16S rRNA. {ECO:0000255|HAMAP-Rule:MF_01343}.; Forms an intersubunit bridge (bridge B4) with the 23S rRNA of the 50S subunit in the ribosome. {ECO:0000255|HAMAP-Rule:MF_01343}. |
| Pubmed ID | |
| Domain | CDD:412325 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B1AIJ1 |
| ORF Length (Amino Acid) | 89 |
++ More..
| Conservation Analysis |
No. of Species: 135
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 249400 | 249669 | - | NC_010503.1 | Ureaplasma parvum serovar 3 str. ATCC 27815 |
| 2 | 236094 | 236363 | - | NC_011374.1 | Ureaplasma urealyticum serovar 10 str. ATCC 33699 |
| 3 | 846224 | 846496 | - | NZ_LR215023.1 | Mycoplasma iowae |
| 4 | 508626 | 508898 | + | NC_004432.1 | Mycoplasma penetrans HF-2 |
| 5 | 41249 | 41515 | - | NZ_LR214951.1 | Mycoplasma neurolyticum |
| 6 | 691117 | 691383 | + | NC_015436.1 | Sphaerochaeta coccoides DSM 17374 |
| 7 | 2017151 | 2017420 | + | NC_018178.1 | Melioribacter roseus P3M-2 |
| 8 | 1924976 | 1925245 | - | NC_023035.1 | Salinispira pacifica |
| 9 | 2187028 | 2187291 | + | NC_014364.1 | Sediminispirochaeta smaragdinae DSM 11293 |
| 10 | 2966122 | 2966391 | - | NZ_CP018099.1 | Caldithrix abyssi DSM 13497 |
| 11 | 452776 | 453042 | + | NC_016633.1 | Sphaerochaeta pleomorpha str. Grapes |
| 12 | 829961 | 830227 | - | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
| 13 | 1841813 | 1842079 | - | NZ_LR699011.1 | Roseburia hominis |
| 14 | 1742072 | 1742341 | + | NC_014221.1 | Truepera radiovictrix DSM 17093 |
| 15 | 341050 | 341319 | + | NC_010803.1 | Chlorobium limicola DSM 245 |
| 16 | 2305869 | 2306135 | - | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 17 | 255921 | 256190 | + | NZ_CP017305.1 | Chlorobaculum limnaeum |
| 18 | 1960344 | 1960613 | - | NC_011027.1 | Chlorobaculum parvum NCIB 8327 |
| 19 | 1044273 | 1044542 | - | NC_022097.1 | Treponema pedis str. T A4 |
| 20 | 3052623 | 3052889 | - | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
| 21 | 340135 | 340386 | - | NZ_LT990039.1 | Massilistercora timonensis |
| 22 | 1508427 | 1508693 | - | NC_015152.1 | Sphaerochaeta globosa str. Buddy |
| 23 | 384512 | 384778 | + | NZ_CP024965.1 | Entomoplasma somnilux |
| 24 | 1180634 | 1180900 | - | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 25 | 1440961 | 1441233 | - | NZ_CP046314.1 | Gemella morbillorum |
| 26 | 417123 | 417392 | + | NC_008639.1 | Chlorobium phaeobacteroides DSM 266 |
| 27 | 707091 | 707360 | - | NZ_CP031513.1 | Bombilactobacillus bombi |
| 28 | 93865 | 94137 | + | NZ_CP059674.1 | Mycoplasma tullyi |
| 29 | 1131848 | 1132117 | + | NZ_CP033433.1 | Cohnella candidum |
| 30 | 3375117 | 3375389 | + | NZ_CP042430.1 | Baekduia soli |
| 31 | 1446916 | 1447185 | - | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 32 | 3321010 | 3321276 | - | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 33 | 4188424 | 4188693 | - | NZ_CP065435.1 | Halomonas sp. SS10-MC5 |
| 34 | 4005566 | 4005802 | - | NZ_CP039126.1 | Blautia producta |
| 35 | 2664632 | 2664898 | - | NZ_CP009888.1 | Pseudoalteromonas piratica |
| 36 | 1250188 | 1250460 | - | NZ_LR134484.1 | Gemella haemolysans |
| 37 | 3636726 | 3636995 | - | NZ_CP014226.1 | Halomonas chromatireducens |
| 38 | 2997334 | 2997603 | - | NZ_CP060401.1 | Xenorhabdus nematophila |
| 39 | 1279587 | 1279856 | - | NC_017583.1 | Spirochaeta thermophila DSM 6578 |
| 40 | 1983220 | 1983489 | - | NC_007512.1 | Pelodictyon luteolum DSM 273 |
| 41 | 1480334 | 1480603 | - | NZ_CP034118.1 | Staphylospora marina |
| 42 | 916261 | 916539 | - | NZ_LR590484.1 | Sphingobacterium thalpophilum |
| 43 | 1397243 | 1397512 | - | NC_015572.1 | Methylomonas methanica MC09 |
| 44 | 1610356 | 1610625 | + | NZ_CP048812.1 | Halomonas socia |
| 45 | 1755556 | 1755825 | - | NC_017098.1 | Spirochaeta africana DSM 8902 |
| 46 | 388566 | 388835 | + | NC_011060.1 | Pelodictyon phaeoclathratiforme BU-1 |
| 47 | 3421451 | 3421720 | - | NC_007963.1 | Chromohalobacter salexigens DSM 3043 |
| 48 | 1037329 | 1037598 | + | NC_007481.1 | Pseudoalteromonas translucida |
| 49 | 1102891 | 1103160 | + | NZ_CP011036.1 | Pseudoalteromonas nigrifaciens |
| 50 | 406845 | 407111 | + | NZ_CP025257.1 | Mesoplasma syrphidae |
| 51 | 1150788 | 1151024 | + | NZ_CP030280.1 | Blautia argi |
| 52 | 2539748 | 2540014 | + | NZ_CP029462.1 | Megasphaera stantonii |
| 53 | 3658631 | 3658897 | + | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 54 | 1891958 | 1892227 | + | NZ_CP018139.1 | Halomonas aestuarii |
| 55 | 4240435 | 4240704 | - | NZ_AP019400.1 | Cohnella abietis |
| 56 | 602482 | 602748 | + | NZ_CP043026.1 | Spiroplasma chinense |
| 57 | 702130 | 702399 | + | NZ_CP041364.1 | Schleiferilactobacillus harbinensis |
| 58 | 615703 | 615972 | + | NZ_CP013988.1 | Aerococcus urinaeequi |
| 59 | 1590943 | 1591212 | - | NZ_CP014164.1 | Aerococcus viridans |
| 60 | 5078273 | 5078545 | - | NZ_CP023777.1 | Chitinophaga caeni |
| 61 | 395895 | 396161 | + | NC_007633.1 | Mycoplasma capricolum subsp. capricolum ATCC 27343 |
| 62 | 925854 | 926123 | + | NZ_CP029477.1 | Lactobacillus kullabergensis |
| 63 | 1897848 | 1898114 | - | NZ_CP011039.1 | Pseudoalteromonas spongiae UST010723-006 |
| 64 | 381136 | 381405 | - | NZ_CP007519.1 | Trueperella pyogenes |
| 65 | 1426274 | 1426537 | + | NZ_CP043998.1 | Clostridium diolis |
| 66 | 1611397 | 1611666 | + | NC_020541.1 | Rhodanobacter denitrificans |
| 67 | 366872 | 367138 | + | NZ_CP025543.1 | Spiroplasma monobiae MQ-1 |
| 68 | 95369 | 95641 | + | NC_018406.1 | Mycoplasma gallisepticum VA94_7994-1-7P |
| 69 | 263120 | 263386 | + | NZ_CP007154.1 | Mycoplasma bovoculi M165/69 |
| 70 | 1159640 | 1159909 | + | NZ_CP011041.1 | Pseudoalteromonas tetraodonis |
| 71 | 1145899 | 1146168 | + | NZ_CP011030.1 | Pseudoalteromonas issachenkonii |
| 72 | 1434318 | 1434587 | + | NZ_AP019312.1 | Chromobacterium haemolyticum |
| 73 | 1421797 | 1422063 | - | NZ_CP036150.1 | Oceanispirochaeta crateris |
| 74 | 528772 | 529041 | + | NZ_AP012331.1 | Bifidobacterium scardovii JCM 12489 = DSM 13734 |
| 75 | 2368792 | 2369061 | + | NZ_CP049253.1 | Microbacterium amylolyticum |
| 76 | 379401 | 379667 | + | NZ_CP001668.1 | Mycoplasma mycoides subsp. capri str. GM12 |
| 77 | 1672145 | 1672414 | - | NZ_AP012273.1 | Thiolapillus brandeum |
| 78 | 2297467 | 2297736 | + | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 79 | 1011182 | 1011451 | + | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 80 | 858134 | 858403 | + | NZ_CP029544.1 | Lactobacillus helsingborgensis |
| 81 | 1618062 | 1618325 | + | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 82 | 730258 | 730527 | + | NZ_CP029476.1 | Lactobacillus apis |
| 83 | 348749 | 349018 | - | NZ_LR134476.1 | Trueperella bialowiezensis |
| 84 | 3021021 | 3021284 | - | NZ_CP014176.1 | Clostridium argentinense |
| 85 | 2382765 | 2383034 | - | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 86 | 1287596 | 1287862 | - | NZ_CP013213.1 | Erysipelothrix larvae |
| 87 | 1582630 | 1582899 | + | NZ_CP022048.2 | Brevundimonas vesicularis |
| 88 | 2062813 | 2063079 | + | NZ_LT906446.1 | Megamonas hypermegale |
| 89 | 6088531 | 6088800 | - | NZ_CP048429.1 | Paenibacillus jilunlii |
| 90 | 4155843 | 4156112 | - | NZ_CP009287.1 | Paenibacillus graminis |
| 91 | 6228080 | 6228349 | - | NZ_CP068595.1 | Paenibacillus sonchi |
| 92 | 4687598 | 4687867 | - | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 93 | 4876563 | 4876832 | - | NZ_CP009285.1 | Paenibacillus borealis |
| 94 | 1210374 | 1210610 | + | NZ_LR134439.1 | Erysipelothrix rhusiopathiae |
| 95 | 1478232 | 1478468 | - | NZ_CP034234.1 | Erysipelothrix piscisicarius |
| 96 | 3581194 | 3581463 | + | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 97 | 4098896 | 4099165 | - | NZ_CP009428.1 | Paenibacillus odorifer |
| 98 | 3651642 | 3651911 | - | NZ_CP021780.1 | Paenibacillus donghaensis |
| 99 | 406617 | 406886 | + | NC_011059.1 | Prosthecochloris aestuarii DSM 271 |
| 100 | 406526 | 406804 | - | NZ_CP049246.1 | Sphingobacterium lactis |
| 101 | 1656901 | 1657164 | - | NZ_CP014204.2 | Clostridium baratii |
| 102 | 15468891 | 15469157 | - | NZ_CP016211.1 | Minicystis rosea |
| 103 | 961647 | 961913 | + | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 104 | 2021720 | 2021956 | - | NZ_CP060715.1 | Erysipelothrix inopinata |
| 105 | 1194817 | 1195080 | + | NZ_CP030775.1 | Clostridium butyricum |
| 106 | 539848 | 540114 | - | NZ_CP024962.1 | Entomoplasma freundtii |
| 107 | 2212885 | 2213154 | - | NZ_CP045072.1 | Paracoccus kondratievae |
| 108 | 820325 | 820597 | + | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 109 | 149522 | 149788 | + | NZ_LR214938.2 | Mycoplasma salivarium |
| 110 | 878668 | 878934 | + | NZ_CP028884.1 | Borrelia turcica IST7 |
| 111 | 886280 | 886552 | + | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
| 112 | 904352 | 904624 | + | NC_012039.1 | Campylobacter lari RM2100 |
| 113 | 1178688 | 1178960 | + | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
| 114 | 990744 | 991016 | + | NZ_CP053848.1 | Campylobacter ornithocola |
| 115 | 2327385 | 2327654 | - | NC_015500.1 | Treponema brennaborense DSM 12168 |
| 116 | 22243 | 22518 | + | NZ_CP063087.1 | Helicobacter winghamensis |
| 117 | 1182150 | 1182416 | - | NZ_AP022321.1 | Veillonella nakazawae |
| 118 | 1237547 | 1237813 | - | NZ_LR134375.1 | Veillonella dispar |
| 119 | 1287177 | 1287443 | - | NZ_LR778174.1 | Veillonella parvula |
| 120 | 945728 | 946000 | + | NZ_CP053825.1 | Campylobacter armoricus |
| 121 | 872461 | 872733 | + | NZ_CP020478.1 | Campylobacter helveticus |
| 122 | 193017 | 193286 | - | NC_014375.1 | Brevundimonas subvibrioides ATCC 15264 |
| 123 | 868544 | 868816 | + | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
| 124 | 497502 | 497774 | - | NZ_CP031611.1 | Campylobacter hepaticus |
| 125 | 6407208 | 6407474 | - | NC_010162.1 | Sorangium cellulosum So ce56 |
| 126 | 2838352 | 2838621 | + | NZ_LN849456.1 | Devriesea agamarum |
| 127 | 525573 | 525845 | - | NZ_CP020921.1 | Thermodesulfobium acidiphilum |
| 128 | 1424888 | 1425154 | + | NZ_CP031115.1 | Rubrobacter indicoceani |
| 129 | 863613 | 863858 | + | NZ_LT906470.1 | Veillonella rodentium |
| 130 | 3650860 | 3651123 | - | NZ_CP071376.1 | Clostridium gasigenes |
| 131 | 1716326 | 1716595 | + | NC_015635.1 | Microlunatus phosphovorus NM-1 |
| 132 | 1168037 | 1168303 | - | NZ_LT632322.1 | Murdochiella vaginalis |
| 133 | 9137030 | 9137299 | - | NC_013131.1 | Catenulispora acidiphila DSM 44928 |
| 134 | 898450 | 898716 | + | NZ_LR134524.1 | Peptoniphilus harei |
| 135 | 338613 | 338882 | + | NZ_LT906481.1 | Corynebacterium urealyticum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015436.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00575.25 | 0.7 | 94 | 224 | same-strand | S1 RNA binding domain |
| 2 | PF01138.23 | 0.7 | 94 | 201 | same-strand | 3' exoribonuclease family, domain 1 |
| 3 | PF03725.17 | 0.67 | 90 | 201 | same-strand | 3' exoribonuclease family, domain 2 |
| 4 | PF03726.16 | 0.69 | 93 | 201 | same-strand | Polyribonucleotide nucleotidyltransferase, RNA binding domain |
| 5 | PF00013.31 | 0.67 | 91 | 203.0 | same-strand | KH domain |
++ More..