Protein Information |
Information Type | Description |
---|---|
Protein name | Nucleoid-associated protein UPA3_0088 |
NCBI Accession ID | CP000942.1 |
Organism | Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) |
Left | 107589 |
Right | 107888 |
Strand | + |
Nucleotide Sequence | ATGGACTTTCAAAAACTTGCACAAGAATTAAAAAAAATGCAAAACACTTTAAGTAAAAAACAAAAAGAATTTGAAGAAAAAGTGTTTGATTTTGATTATAAAGGATATGTACTTGTTAAAATCAAAGGTGATTTAAATATTGAAGCAATTGAAATAAAAACAGAAATAGTGGATCCTGAAGACAAAGAAACATTACAAGATATTTTACGTGCAGCGATCAATGAAGCAATCTCTATAACATGTAAAGAACGAGATGCGATTATGAATGCTACAATCCCTAAAGGAACAGGTCTTTTTTAG |
Sequence | MDFQKLAQELKKMQNTLSKKQKEFEEKVFDFDYKGYVLVKIKGDLNIEAIEIKTEIVDPEDKETLQDILRAAINEAISITCKERDAIMNATIPKGTGLF |
Source of smORF | Swiss-Prot |
Function | Binds to DNA and alters its conformation. May be involved in regulation of gene expression, nucleoid organization and DNA protection. {ECO:0000255|HAMAP-Rule:MF_00274}. |
Pubmed ID | |
Domain | CDD:412410 |
Functional Category | DNA-binding |
Uniprot ID | B1AI74 |
ORF Length (Amino Acid) | 99 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 107589 | 107888 | + | NC_010503.1 | Ureaplasma parvum serovar 3 str. ATCC 27815 |
2 | 118060 | 118359 | + | NC_011374.1 | Ureaplasma urealyticum serovar 10 str. ATCC 33699 |
3 | 869427 | 869720 | - | NZ_LR215023.1 | Mycoplasma iowae |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13662.8 | 1.0 | 3 | 102 | same-strand | Toprim domain |
2 | PF02132.17 | 0.67 | 2 | 52.5 | same-strand | RecR protein |
3 | PF01751.24 | 0.67 | 2 | 52.5 | same-strand | Toprim domain |
4 | PF02881.21 | 0.67 | 2 | 2829.0 | same-strand | SRP54-type protein, helical bundle domain |