Result : EXP00218
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00218 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 1792017 |
| Right | 1792121 |
| Strand | - |
| Nucleotide Sequence | ATGGAACAAATGAAAGTTACTCCTTCTGTAATTGTTATGTCTTATGGCCTCATCCCTTTTAGCCGGATACTGAAAAACATCCTTCGAGAGGGACGGTTACCATGA |
| Sequence | MEQMKVTPSVIVMSYGLIPFSRILKNILREGRLP |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 27013550 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 34 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2391868 | 2391972 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 1792017 | 1792121 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 1554886 | 1554990 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 1963034 | 1963138 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 5 | 2037419 | 2037514 | + | NZ_LR134340.1 | Escherichia marmotae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03618.16 | 0.75 | 3 | 3739.0 | opposite-strand | Kinase/pyrophosphorylase |
| 2 | PF00793.22 | 1.0 | 4 | 2536 | opposite-strand | DAHP synthetase I family |
| 3 | PF10636.11 | 1.0 | 4 | 2213 | opposite-strand | Hemin uptake protein hemP |
| 4 | PF02696.16 | 0.75 | 3 | 773.0 | same-strand | Protein adenylyltransferase SelO |
| 5 | PF00563.22 | 1.0 | 4 | -3 | same-strand | EAL domain |
| 6 | PF00877.21 | 1.0 | 4 | 146 | same-strand | NlpC/P60 family |
| 7 | PF00005.29 | 1.0 | 4 | 688 | same-strand | ABC transporter |
| 8 | PF13191.8 | 0.75 | 3 | 688.0 | same-strand | AAA ATPase domain |
| 9 | PF00255.21 | 1.0 | 4 | 1437 | same-strand | Glutathione peroxidase |
| 10 | PF01032.20 | 1.0 | 4 | 2051 | same-strand | FecCD transport family |
| 11 | PF00216.23 | 1.0 | 4 | 3132 | same-strand | Bacterial DNA-binding protein |
++ More..