Result : EXP00213
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00213 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 641540 |
| Right | 641677 |
| Strand | - |
| Nucleotide Sequence | ATGAAGCACAAGAACGTCTGCAAACGATGGTCAGCCACTTCACCATCGATCCTTCCCGCATTAAACAACATGTCCGTTTTGGTAGCGTGCGGGATGAAGTCAATGAGTTGGCAGAAGAACTGGGGGCTGATGTTGTAG |
| Sequence | MKHKNVCKRWSATSPSILPALNNMSVLVACGMKSMSWQKNWGLML |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 27013550 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 45 |
++ More..
| Conservation Analysis |
No. of Species: 10
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 641540 | 641677 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 547387 | 547524 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 3086311 | 3086448 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 1531894 | 1532004 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 5 | 677473 | 677613 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 6 | 1298727 | 1298849 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 7 | 2855112 | 2855234 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 8 | 4171244 | 4171384 | - | NZ_CP033744.1 | Citrobacter freundii |
| 9 | 945513 | 945653 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 10 | 684320 | 684478 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00578.23 | 0.6 | 6 | 1994.5 | opposite-strand | AhpC/TSA family |
| 2 | PF08534.12 | 0.6 | 6 | 1994.5 | opposite-strand | Redoxin |
| 3 | PF07992.16 | 0.7 | 7 | 222 | opposite-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 4 | PF00070.29 | 0.7 | 7 | 222 | opposite-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 5 | PF13192.8 | 0.7 | 7 | 222 | opposite-strand | Thioredoxin domain |
| 6 | PF00582.28 | 1.0 | 10 | -137 | same-strand | Universal stress protein family |
| 7 | PF01272.21 | 0.9 | 9 | 1717 | same-strand | Transcription elongation factor, GreA/GreB, C-term |
| 8 | PF14760.8 | 0.9 | 9 | 1717 | same-strand | Rnk N-terminus |
| 9 | PF00445.20 | 0.9 | 9 | 2634 | same-strand | Ribonuclease T2 family |
++ More..