Protein Information |
Information Type | Description |
---|---|
Protein name | EXP00213 |
NCBI Accession ID | NC_000913.3 |
Organism | Escherichia coli str. K-12 substr. MG1655 |
Left | 641540 |
Right | 641677 |
Strand | - |
Nucleotide Sequence | ATGAAGCACAAGAACGTCTGCAAACGATGGTCAGCCACTTCACCATCGATCCTTCCCGCATTAAACAACATGTCCGTTTTGGTAGCGTGCGGGATGAAGTCAATGAGTTGGCAGAAGAACTGGGGGCTGATGTTGTAG |
Sequence | MKHKNVCKRWSATSPSILPALNNMSVLVACGMKSMSWQKNWGLML |
Source of smORF | Ribo-seq |
Function | |
Pubmed ID | 30904393 27013550 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 45 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 641540 | 641677 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
2 | 547387 | 547524 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
3 | 3086311 | 3086448 | + | NZ_CP061527.1 | Shigella dysenteriae |
4 | 1531894 | 1532004 | + | NZ_CP057657.1 | Escherichia fergusonii |
5 | 677473 | 677613 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
6 | 1298727 | 1298849 | - | NZ_CP009756.1 | Enterobacter cloacae |
7 | 2855112 | 2855234 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
8 | 4171244 | 4171384 | - | NZ_CP033744.1 | Citrobacter freundii |
9 | 945513 | 945653 | + | NZ_CP044098.1 | Citrobacter portucalensis |
10 | 684320 | 684478 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00578.23 | 0.6 | 6 | 1994.5 | opposite-strand | AhpC/TSA family |
2 | PF08534.12 | 0.6 | 6 | 1994.5 | opposite-strand | Redoxin |
3 | PF07992.16 | 0.7 | 7 | 222 | opposite-strand | Pyridine nucleotide-disulphide oxidoreductase |
4 | PF00070.29 | 0.7 | 7 | 222 | opposite-strand | Pyridine nucleotide-disulphide oxidoreductase |
5 | PF13192.8 | 0.7 | 7 | 222 | opposite-strand | Thioredoxin domain |
6 | PF00582.28 | 1.0 | 10 | -137 | same-strand | Universal stress protein family |
7 | PF01272.21 | 0.9 | 9 | 1717 | same-strand | Transcription elongation factor, GreA/GreB, C-term |
8 | PF14760.8 | 0.9 | 9 | 1717 | same-strand | Rnk N-terminus |
9 | PF00445.20 | 0.9 | 9 | 2634 | same-strand | Ribonuclease T2 family |