Result : B0VL58

Protein Information

• Protein name: Sec-independent protein translocase protein TatA
• NCBI Accession ID: CU468230.2
• Organism: Acinetobacter baumannii (strain SDF)
• Left: 2800931
• Right: 2801149
• Strand: +
• Nucleotide Sequence: ATGGCTGGTTTATCTATTTGGCATGTCGTTATTTTCGCAATTGTCGTTATTTTATTGTTCGGTACATCTAAGCTAAAAAATATCGGTAAAGATGTAGGCGGTGCAGTAAGAGATTTTAAAAAGTCAGTTCGTGAAGAAGACGAAGCTGCATCTTTAAATAGCCCTCGTACAATTGATGCACAAGCTAAAACATCTGAAAGCACATCAGTGAAAAGCTAA
• Sequence: MAGLSIWHVVIFAIVVILLFGTSKLKNIGKDVGGAVRDFKKSVREEDEAASLNSPRTIDAQAKTSESTSVKS
• Source of smORF: Swiss-Prot
• Function: Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}.
• Pubmed ID: 18350144
• Domain: CDD:294511
• Functional Category: Others
• Uniprot ID: B0VL58
• ORF Length (Amino Acid): 72

Conservation Analysis

No. of Species: 24

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	3434459	3434677	+	NZ_CP015121.1	Acinetobacter baumannii
2	1533736	1533954	+	NZ_CP040105.1	Acinetobacter nosocomialis M2
3	3556332	3556550	+	NZ_CP065820.1	Acinetobacter seifertii
4	3457517	3457735	+	NZ_CP053391.1	Acinetobacter lactucae
5	3642311	3642529	+	NC_014259.1	Acinetobacter oleivorans DR1
6	1426683	1426901	+	NZ_CP070518.1	Acinetobacter calcoaceticus
7	3627061	3627279	-	NC_016603.1	Acinetobacter pittii PHEA-2
8	507071	507286	-	NZ_CP024632.1	Acinetobacter junii
9	3595366	3595581	-	NZ_CP041970.1	Acinetobacter dispersus
10	465947	466165	-	NZ_CP030880.1	Acinetobacter haemolyticus
11	1584013	1584231	-	NZ_CP044483.1	Acinetobacter schindleri
12	2973894	2974112	+	NZ_CP035934.2	Acinetobacter cumulans
13	3098036	3098254	+	NZ_CP032134.1	Acinetobacter chinensis
14	403585	403803	+	NZ_CP012808.1	Acinetobacter equi
15	160433	160657	+	NZ_CP071766.1	Acinetobacter towneri
16	445367	445585	-	NZ_CP045650.1	Acinetobacter wanghuae
17	2872170	2872394	+	NZ_CP049916.1	Acinetobacter lanii
18	2931738	2931959	+	NZ_CP029397.2	Acinetobacter defluvii
19	569797	570021	-	NZ_AP014630.1	Acinetobacter guillouiae
20	1721532	1721756	+	NZ_AP014630.1	Acinetobacter guillouiae
21	595172	595387	-	NZ_CP049801.1	Acinetobacter shaoyimingii
22	509893	510114	-	NC_005966.1	Acinetobacter baylyi ADP1
23	1877068	1877283	-	NZ_CP009238.1	Basilea psittacipulmonis DSM 24701
24	195364	195582	-	NZ_CP031222.1	Aquirhabdus parva
25	1483820	1484035	-	NZ_CP047165.1	Pelistega ratti

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_CP015121.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF07021.14	0.71	17	2715	same-strand	Methionine biosynthesis protein MetW
2	PF08241.14	0.71	17	2715	same-strand	Methyltransferase domain
3	PF13489.8	0.71	17	2715	same-strand	Methyltransferase domain
4	PF13649.8	0.71	17	2715	same-strand	Methyltransferase domain
5	PF08242.14	0.71	17	2715	same-strand	Methyltransferase domain
6	PF08238.14	0.79	19	2137	same-strand	Sel1 repeat
7	PF01725.18	0.83	20	1165.0	same-strand	Ham1 family
8	PF02416.18	0.83	20	13.0	same-strand	mttA/Hcf106 family
9	PF00902.20	1.0	24	450	same-strand	Sec-independent protein translocase protein (TatC)
10	PF05742.14	0.79	19	3673	opposite-strand	Transport and Golgi organisation 2