Result : EXP00200
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00200 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 1269512 |
| Right | 1269688 |
| Strand | + |
| Nucleotide Sequence | ATGAAGAGTGCATTCCGGTTTTTCAACAGCTGTTACAGTCATTTCATGAGTGCTCTGGATGAGGCTTCCAGCTCGGGTTGCCAATATTTACTTGTGGAAGTGATAAAGACAAAAATGGCCGCAGGCTGTTACCCCTGCGGCCGGTTTCGGGCGCATATTGCCATCACGGCAGCCTGA |
| Sequence | MKSAFRFFNSCYSHFMSALDEASSSGCQYLLVEVIKTKMAAGCYPCGRFRAHIAITAA |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 27013550 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 58 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1269512 | 1269688 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 1270038 | 1270223 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 2433140 | 2433316 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 1715531 | 1715707 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP061527.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF17827.3 | 1.0 | 2 | 2585 | same-strand | PrmC N-terminal domain |
| 2 | PF13649.8 | 1.0 | 2 | 2585 | same-strand | Methyltransferase domain |
| 3 | PF04247.14 | 1.0 | 2 | 2196.0 | same-strand | Invasion gene expression up-regulator, SirB |
| 4 | PF13369.8 | 1.0 | 2 | 1383.0 | same-strand | Transglutaminase-like superfamily |
| 5 | PF13371.8 | 1.0 | 2 | 1383.0 | same-strand | Tetratricopeptide repeat |
| 6 | PF00793.22 | 1.0 | 2 | 493.0 | same-strand | DAHP synthetase I family |
| 7 | PF13940.8 | 1.0 | 2 | 232.5 | opposite-strand | Toxin Ldr, type I toxin-antitoxin system |
| 8 | PF01699.26 | 1.0 | 2 | 526.5 | opposite-strand | Sodium/calcium exchanger protein |
| 9 | PF06150.14 | 1.0 | 2 | 2163.5 | same-strand | ChaB |
| 10 | PF04752.14 | 1.0 | 2 | 2530.5 | same-strand | ChaC-like protein |
| 11 | PF02635.17 | 1.0 | 2 | 3023 | opposite-strand | DsrE/DsrF-like family |
++ More..