Result : B0UT78
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0434 protein HSM_0997 |
| NCBI Accession ID | CP000947.1 |
| Organism | Histophilus somni (strain 2336) (Haemophilus somnus) |
| Left | 1136383 |
| Right | 1136580 |
| Strand | + |
| Nucleotide Sequence | ATGAACGGAAGATTATTAGAAATTGTCGCATGTCCAATTTGCCAAGGGCGATTGAAATACGACAGTGAAAATGAGCAACTTATTTGTCACTTTGATCATATTGCTTACCCTATTAAACAAGGTATTCCAATTTTACTTTCCGATCAGGCAATCGGTTTGTCTACATCTTTAACCAATCCTGAGCAACAAAATCAGTAA |
| Sequence | MNGRLLEIVACPICQGRLKYDSENEQLICHFDHIAYPIKQGIPILLSDQAIGLSTSLTNPEQQNQ |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01066. Profile Description: Trm112p-like protein. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C-terminus contains the strongest conservation. Trm112p is required for tRNA methylation in S. cerevisiae and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices. |
| Pubmed ID | |
| Domain | CDD:412721 |
| Functional Category | Others |
| Uniprot ID | B0UT78 |
| ORF Length (Amino Acid) | 65 |
++ More..
| Conservation Analysis |
No. of Species: 119
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1502575 | 1502772 | - | NZ_CP018804.1 | Histophilus somni |
| 2 | 1725862 | 1726071 | - | NZ_LR134167.1 | Avibacterium volantium |
| 3 | 912679 | 912864 | + | NC_006300.1 | [Mannheimia] succiniciproducens MBEL55E |
| 4 | 531108 | 531293 | + | NZ_CP015031.1 | Basfia succiniciproducens |
| 5 | 1807132 | 1807311 | + | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
| 6 | 3122353 | 3122529 | - | NZ_CP034015.1 | Shewanella livingstonensis |
| 7 | 550594 | 550773 | - | NZ_CP037953.1 | Permianibacter aggregans |
| 8 | 1794935 | 1795117 | + | NZ_CP028926.1 | Pasteurella multocida |
| 9 | 2703065 | 2703241 | - | NZ_CP041036.1 | Shewanella polaris |
| 10 | 2234353 | 2234532 | - | NZ_CP031781.1 | Vibrio parahaemolyticus |
| 11 | 1795558 | 1795737 | - | NZ_CP016176.1 | Xenorhabdus hominickii |
| 12 | 1448565 | 1448744 | + | NZ_CP046268.1 | Vibrio spartinae |
| 13 | 1019634 | 1019813 | + | NZ_CP032093.1 | Vibrio alfacsensis |
| 14 | 2630233 | 2630412 | - | NC_013456.1 | Vibrio antiquarius |
| 15 | 3273699 | 3273881 | - | NZ_CP023525.1 | Cedecea neteri |
| 16 | 1649502 | 1649681 | - | NZ_CP014035.2 | Vibrio fluvialis |
| 17 | 1590757 | 1590939 | + | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 18 | 1572681 | 1572860 | + | NZ_CP005974.1 | Photobacterium gaetbulicola Gung47 |
| 19 | 1806160 | 1806339 | - | NZ_LT960611.1 | Vibrio tapetis subsp. tapetis |
| 20 | 993398 | 993577 | + | NZ_CP030788.1 | Vibrio campbellii |
| 21 | 2038292 | 2038471 | - | NZ_CP018312.1 | Vibrio rotiferianus |
| 22 | 789562 | 789741 | - | NZ_CP019959.1 | Vibrio owensii |
| 23 | 1279244 | 1279423 | + | NZ_CP009467.1 | Vibrio harveyi |
| 24 | 1178760 | 1178939 | - | NZ_CP025792.1 | Vibrio jasicida 090810c |
| 25 | 2847796 | 2847972 | - | NC_008345.1 | Shewanella frigidimarina NCIMB 400 |
| 26 | 1824283 | 1824465 | + | NZ_LR134494.1 | Serratia quinivorans |
| 27 | 1860069 | 1860248 | - | NZ_CP009977.1 | Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759 |
| 28 | 1021517 | 1021696 | + | NZ_CP022741.1 | Vibrio qinghaiensis |
| 29 | 1592495 | 1592674 | + | NZ_CP040990.1 | Vibrio furnissii |
| 30 | 1144488 | 1144676 | - | NZ_CP017754.1 | Cupriavidus malaysiensis |
| 31 | 2885653 | 2885832 | + | NZ_CP026364.1 | Proteus hauseri |
| 32 | 792440 | 792619 | + | NC_010554.1 | Proteus mirabilis HI4320 |
| 33 | 426574 | 426756 | + | NZ_CP067057.1 | Rahnella aceris |
| 34 | 2928416 | 2928598 | - | NZ_AP023184.1 | Buttiauxella agrestis |
| 35 | 2252294 | 2252473 | - | NZ_CP060401.1 | Xenorhabdus nematophila |
| 36 | 3145006 | 3145188 | + | NZ_CP040428.1 | Jejubacter calystegiae |
| 37 | 1829950 | 1830132 | + | NC_015567.1 | Serratia plymuthica AS9 |
| 38 | 2228005 | 2228184 | - | NZ_CP071325.1 | Photobacterium ganghwense |
| 39 | 1120258 | 1120446 | - | NZ_LT906448.1 | Pasteurella dagmatis |
| 40 | 2100241 | 2100423 | - | NZ_CP047475.1 | Vibrio astriarenae |
| 41 | 1875668 | 1875847 | - | NZ_AP014524.1 | Vibrio cholerae MS6 |
| 42 | 2704180 | 2704362 | + | NZ_CP014056.2 | Grimontia hollisae |
| 43 | 1313113 | 1313292 | - | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
| 44 | 3239524 | 3239706 | + | NZ_CP065640.1 | Serratia rubidaea |
| 45 | 1576965 | 1577144 | + | NZ_FO704550.1 | Xenorhabdus doucetiae |
| 46 | 3057973 | 3058155 | - | NZ_LR134201.1 | Cedecea lapagei |
| 47 | 4249093 | 4249275 | - | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
| 48 | 38682 | 38861 | + | NZ_CP046793.1 | Vibrio metschnikovii |
| 49 | 1637724 | 1637903 | + | NZ_CP070624.1 | Photobacterium damselae subsp. damselae |
| 50 | 1857606 | 1857788 | + | NZ_LT906479.1 | Serratia ficaria |
| 51 | 772545 | 772730 | - | NZ_CP022987.1 | Pusillimonas thiosulfatoxidans |
| 52 | 4540766 | 4540948 | + | NZ_CP014136.1 | Gibbsiella quercinecans |
| 53 | 1659361 | 1659543 | + | NZ_CP026377.1 | Mixta gaviniae |
| 54 | 1491421 | 1491600 | - | NZ_AP018689.1 | Vibrio aphrogenes |
| 55 | 2306836 | 2307015 | - | NZ_AP014635.1 | Vibrio tritonius |
| 56 | 2167732 | 2167914 | + | NZ_CP025799.1 | Dickeya zeae |
| 57 | 826828 | 827007 | - | NC_013892.1 | Xenorhabdus bovienii SS-2004 |
| 58 | 1180327 | 1180506 | + | NZ_AP018685.1 | Vibrio rumoiensis |
| 59 | 2056028 | 2056189 | + | NC_016901.1 | Shewanella baltica OS678 |
| 60 | 1534941 | 1535123 | - | NZ_CP040021.1 | Salinivibrio kushneri |
| 61 | 818496 | 818678 | + | NZ_CP028271.1 | Mixta intestinalis |
| 62 | 3036704 | 3036886 | - | NZ_CP006569.1 | Sodalis praecaptivus |
| 63 | 1581584 | 1581766 | + | NZ_CP061511.1 | Mixta calida |
| 64 | 39665 | 39847 | - | NZ_CP019706.1 | Pantoea alhagi |
| 65 | 1767376 | 1767558 | + | NZ_CP048784.1 | Serratia liquefaciens |
| 66 | 3015361 | 3015543 | - | NC_017554.1 | Pantoea ananatis PA13 |
| 67 | 2083525 | 2083704 | - | NZ_CP009354.1 | Vibrio tubiashii ATCC 19109 |
| 68 | 45048 | 45227 | + | NZ_CP040863.1 | Rodentibacter heylii |
| 69 | 3680715 | 3680897 | + | NZ_CP011078.1 | Yersinia ruckeri |
| 70 | 2860944 | 2861123 | - | NZ_CP072455.1 | Xenorhabdus budapestensis |
| 71 | 2547547 | 2547726 | + | NZ_CP065150.1 | Vibrio kanaloae |
| 72 | 2210004 | 2210183 | - | NC_011753.2 | Vibrio atlanticus |
| 73 | 2174491 | 2174670 | - | NZ_CP039700.1 | Vibrio cyclitrophicus |
| 74 | 3232088 | 3232270 | - | NZ_CP071320.1 | Serratia ureilytica |
| 75 | 1818515 | 1818697 | + | NZ_CP038662.1 | Serratia nematodiphila |
| 76 | 1074488 | 1074670 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 77 | 2570145 | 2570327 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 78 | 1125411 | 1125590 | + | NZ_AP019651.1 | Vibrio taketomensis |
| 79 | 1684658 | 1684837 | - | NZ_AP019657.1 | Vibrio ponticus |
| 80 | 2640630 | 2640812 | - | NC_012912.1 | Dickeya chrysanthemi Ech1591 |
| 81 | 1124503 | 1124685 | + | NZ_CP016948.1 | Serratia surfactantfaciens |
| 82 | 1651503 | 1651700 | + | NZ_CP013232.1 | Collimonas fungivorans |
| 83 | 2840408 | 2840590 | - | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 84 | 3412036 | 3412218 | + | NZ_CP007230.1 | Yersinia similis |
| 85 | 3296846 | 3297028 | - | NZ_CP023009.1 | Lonsdalea britannica |
| 86 | 1767961 | 1768140 | - | NZ_CP016414.1 | Vibrio scophthalmi |
| 87 | 2951870 | 2952043 | - | NZ_CP020472.1 | Shewanella japonica |
| 88 | 2049221 | 2049403 | - | NZ_CP065534.1 | Lonsdalea populi |
| 89 | 2322528 | 2322710 | - | NZ_CP042220.2 | Dickeya poaceiphila |
| 90 | 2092390 | 2092572 | + | NZ_CP038498.1 | Pectobacterium punjabense |
| 91 | 1491010 | 1491189 | - | NZ_CP016605.1 | Bisgaardia hudsonensis |
| 92 | 1483580 | 1483762 | + | NZ_LS483470.1 | Leminorella richardii |
| 93 | 1120422 | 1120604 | - | NZ_CP009787.1 | Yersinia rohdei |
| 94 | 1013549 | 1013731 | - | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 95 | 4028641 | 4028823 | - | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| 96 | 1824870 | 1825052 | + | NZ_CP043727.1 | Yersinia canariae |
| 97 | 1798554 | 1798736 | + | NZ_CP011118.1 | Yersinia enterocolitica |
| 98 | 1301574 | 1301756 | + | NZ_CP032487.1 | Yersinia hibernica |
| 99 | 2814200 | 2814382 | - | NZ_CP046293.1 | Yersinia intermedia |
| 100 | 4375549 | 4375731 | + | NZ_CP015137.1 | Dickeya solani IPO 2222 |
| 101 | 2224232 | 2224414 | + | NC_014500.1 | Dickeya dadantii 3937 |
| 102 | 586521 | 586703 | - | NZ_CP009460.1 | Dickeya fangzhongdai |
| 103 | 1335071 | 1335259 | + | NZ_CP011930.1 | Herbaspirillum seropedicae |
| 104 | 3396084 | 3396269 | - | NZ_CP048878.1 | Spartinivicinus ruber |
| 105 | 1831544 | 1831723 | + | NZ_CP022358.1 | Shewanella bicestrii |
| 106 | 2406974 | 2407156 | - | NC_010694.1 | Erwinia tasmaniensis Et1/99 |
| 107 | 2155987 | 2156169 | + | NZ_CP031560.1 | Dickeya dianthicola |
| 108 | 2599172 | 2599354 | - | NC_012880.1 | Musicola paradisiaca Ech703 |
| 109 | 4295143 | 4295316 | + | NZ_CP036200.1 | Shewanella maritima |
| 110 | 1268063 | 1268251 | + | NZ_CP037993.1 | Herbaspirillum huttiense |
| 111 | 2140413 | 2140595 | + | NZ_LT615367.1 | Dickeya aquatica |
| 112 | 1473336 | 1473509 | + | NZ_LT906463.1 | Haemophilus pittmaniae |
| 113 | 2854032 | 2854214 | - | NZ_CP028897.1 | Dongshaea marina |
| 114 | 1132450 | 1132629 | + | NC_008709.1 | Psychromonas ingrahamii 37 |
| 115 | 1679162 | 1679359 | + | NZ_CP032090.1 | Pseudoalteromonas donghaensis |
| 116 | 3408928 | 3409092 | + | NZ_CP019948.1 | Methylocystis bryophila |
| 117 | 2271715 | 2271891 | - | NC_016041.1 | Glaciecola nitratireducens FR1064 |
| 118 | 918763 | 918957 | + | NZ_CP011367.1 | Thioalkalivibrio versutus |
| 119 | 435761 | 435931 | + | NC_000918.1 | Aquifex aeolicus VF5 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR134167.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02348.21 | 0.92 | 110 | 0.0 | same-strand | Cytidylyltransferase |
| 2 | PF02606.16 | 0.97 | 116 | 33.0 | same-strand | Tetraacyldisaccharide-1-P 4'-kinase |
| 3 | PF00664.25 | 0.84 | 100 | 1049.0 | same-strand | ABC transporter transmembrane region |
| 4 | PF00005.29 | 0.84 | 100 | 1049.5 | same-strand | ABC transporter |
| 5 | PF13191.8 | 0.62 | 74 | 1043.5 | same-strand | AAA ATPase domain |
| 6 | PF03772.18 | 0.76 | 90 | 2848.0 | same-strand | Competence protein |
| 7 | PF00753.29 | 0.7 | 83 | 2837 | same-strand | Metallo-beta-lactamase superfamily |
++ More..