Result : EXP00186
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00186 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 1079024 |
| Right | 1079146 |
| Strand | + |
| Nucleotide Sequence | ATGACAGGGATTAAAAAAATAACTCAGACTTTTTCTCTGCGGCAGTTAACATTTTTGAAAGGTGCAACCGCAAAAAATGTGAGAGAGTGCAACCTGATGAAAAATAGTGTCGCTGAGCACTAA |
| Sequence | MTGIKKITQTFSLRQLTFLKGATAKNVRECNLMKNSVAEH |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 27013550 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 40 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1319986 | 1320108 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 1079024 | 1079146 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 2671727 | 2671849 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 953085 | 953207 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 5 | 1734312 | 1734431 | + | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 1084266 | 1084385 | + | NZ_AP014857.1 | Escherichia albertii |
| 7 | 1892751 | 1892894 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 8 | 3382193 | 3382327 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 9 | 598734 | 598832 | + | NZ_CP023529.1 | Lelliottia amnigena |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08362.13 | 0.88 | 7 | 4144.0 | same-strand | YcdC-like protein, C-terminal region |
| 2 | PF00440.25 | 0.88 | 7 | 4144.0 | same-strand | Bacterial regulatory proteins, tetR family |
| 3 | PF00171.24 | 1.0 | 8 | 142 | opposite-strand | Aldehyde dehydrogenase family |
| 4 | PF01619.20 | 1.0 | 8 | 142 | opposite-strand | Proline dehydrogenase |
| 5 | PF14850.8 | 1.0 | 8 | 142 | opposite-strand | DNA-binding domain of Proline dehydrogenase |
| 6 | PF18327.3 | 1.0 | 8 | 142 | opposite-strand | Proline utilization A proline dehydrogenase N-terminal domain |
| 7 | PF00474.19 | 1.0 | 8 | 159 | same-strand | Sodium:solute symporter family |
| 8 | PF03239.16 | 0.75 | 6 | 1887 | same-strand | Iron permease FTR1 family |
| 9 | PF09375.12 | 0.75 | 6 | 2775 | same-strand | Imelysin |
| 10 | PF13473.8 | 0.75 | 6 | 2775 | same-strand | Cupredoxin-like domain |
| 11 | PF04261.14 | 0.62 | 5 | 3907 | same-strand | Dyp-type peroxidase family |
++ More..