Result : EXP00182

Protein Information

• Protein name: EXP00182
• NCBI Accession ID: NC_000913.3
• Organism: Escherichia coli str. K-12 substr. MG1655
• Left: 237289
• Right: 237399
• Strand: +
• Nucleotide Sequence: ATGCTAAATATTCTAATCATTATGACAGGCGAGGGAGTGTCCAATTATGAATTCAAAAAAGCTTTGTTGCATATGTGTGTTATTCTCGCTGCTTGCAGGATGTGCCTCTGA
• Sequence: MLNILIIMTGEGVSNYEFKKALLHMCVILAACRMCL
• Source of smORF: Ribo-seq
• Pubmed ID: 30904393 27013550
• Functional Category: Function not yet assigned
• ORF Length (Amino Acid): 36

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	240841	240951	+	NC_002695.2	Escherichia coli O157:H7 str. Sakai
2	237289	237399	+	NC_000913.3	Escherichia coli str. K-12 substr. MG1655
3	238686	238796	+	NZ_AP014857.1	Escherichia albertii

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_002695.2

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF01476.22	1.0	2	3472	opposite-strand	LysM domain
2	PF01464.22	1.0	2	3472	opposite-strand	Transglycosylase SLT domain
3	PF00753.29	1.0	2	2508	opposite-strand	Metallo-beta-lactamase superfamily
4	PF16123.7	1.0	2	2508	opposite-strand	Hydroxyacylglutathione hydrolase C-terminus
5	PF00075.26	1.0	2	1288	opposite-strand	RNase H
6	PF00929.26	1.0	2	492	same-strand	Exonuclease
7	PF16473.7	1.0	2	492	same-strand	3' exoribonuclease, RNase T-like