ProsmORF-pred
Result : EXP00182
Protein Information
Information Type Description
Protein name EXP00182
NCBI Accession ID NC_000913.3
Organism Escherichia coli str. K-12 substr. MG1655
Left 237289
Right 237399
Strand +
Nucleotide Sequence ATGCTAAATATTCTAATCATTATGACAGGCGAGGGAGTGTCCAATTATGAATTCAAAAAAGCTTTGTTGCATATGTGTGTTATTCTCGCTGCTTGCAGGATGTGCCTCTGA
Sequence MLNILIIMTGEGVSNYEFKKALLHMCVILAACRMCL
Source of smORF Ribo-seq
Function
Pubmed ID 30904393 27013550
Domain
Functional Category Function not yet assigned
Uniprot ID
ORF Length (Amino Acid) 36
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 2
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 240841 240951 + NC_002695.2 Escherichia coli O157:H7 str. Sakai
2 237289 237399 + NC_000913.3 Escherichia coli str. K-12 substr. MG1655
3 238686 238796 + NZ_AP014857.1 Escherichia albertii
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_002695.2
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF01476.22 1.0 2 3472 opposite-strand LysM domain
2 PF01464.22 1.0 2 3472 opposite-strand Transglycosylase SLT domain
3 PF00753.29 1.0 2 2508 opposite-strand Metallo-beta-lactamase superfamily
4 PF16123.7 1.0 2 2508 opposite-strand Hydroxyacylglutathione hydrolase C-terminus
5 PF00075.26 1.0 2 1288 opposite-strand RNase H
6 PF00929.26 1.0 2 492 same-strand Exonuclease
7 PF16473.7 1.0 2 492 same-strand 3' exoribonuclease, RNase T-like
++ More..