Result : EXP00180
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00180 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 3526362 |
| Right | 3526472 |
| Strand | + |
| Nucleotide Sequence | ATGATGCTCAAGTTAAACTCCACGCTTGCCGATAGCCAACCGCAGAATCATGTATTGTGTCCGGTGCGACTGACCACGCCTGACAGACTAAGTAAGATGGGGAAAGCATGA |
| Sequence | MMLKLNSTLADSQPQNHVLCPVRLTTPDRLSKMGKA |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 27013550 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 36 |
++ More..
| Conservation Analysis |
No. of Species: 11
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4238684 | 4238794 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 3526362 | 3526472 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 183470 | 183580 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 3495576 | 3495686 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 5 | 4680700 | 4680810 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 6 | 74685 | 74795 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 7 | 1607652 | 1607762 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 8 | 4247793 | 4247900 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 9 | 2949290 | 2949400 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 10 | 4350298 | 4350408 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 11 | 4686088 | 4686198 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 12 | 4337968 | 4338078 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_013716.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00912.24 | 1.0 | 11 | 863.0 | same-strand | Transglycosylase |
| 2 | PF17092.7 | 1.0 | 11 | 863.0 | same-strand | Penicillin-binding protein OB-like domain |
| 3 | PF00293.30 | 1.0 | 11 | 218.0 | opposite-strand | NUDIX domain |
| 4 | PF07095.13 | 1.0 | 11 | -3.0 | same-strand | Intracellular growth attenuator protein IgaA |
| 5 | PF13419.8 | 1.0 | 11 | 2197.0 | same-strand | Haloacid dehalogenase-like hydrolase |
| 6 | PF01479.27 | 1.0 | 11 | 2876.0 | same-strand | S4 domain |
| 7 | PF01430.21 | 1.0 | 11 | 3302.0 | same-strand | Hsp33 protein |
| 8 | PF01293.22 | 0.64 | 7 | 4552 | same-strand | Phosphoenolpyruvate carboxykinase |
++ More..