Result : A0M1H4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) |
| NCBI Accession ID | CU207366.1 |
| Organism | Gramella forsetii (strain KT0803) |
| Left | 1546904 |
| Right | 1547197 |
| Strand | - |
| Nucleotide Sequence | GTGATGAATAAATTAAGTGAGGAAGAGATTCAGGATAAACTAAAAAAGTTTGATGGTTGGACGTATGCCAAAAAATCAATTCATACTTCATTTCAATTTGAGAACTTCAAAGAAGCATTTACAGTAATGACACGCATTGCTTTTGAAGCGGAAGCACAACAACATCACCCAAATTGGGGAAATGTCTTTAACGAGCTGGAGATCTCACTTTCCACTCATGATGCCGATGGTGTTACTGAAAAAGATTTTAAATTGGCAAGAGCCATTGAAGATATAGTTGAGTCTACGAATTAA |
| Sequence | MMNKLSEEEIQDKLKKFDGWTYAKKSIHTSFQFENFKEAFTVMTRIAFEAEAQQHHPNWGNVFNELEISLSTHDADGVTEKDFKLARAIEDIVESTN |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00942. Profile Description: N/A. Pterin 4 alpha carbinolamine dehydratase is also known as DCoH (dimerization cofactor of hepatocyte nuclear factor 1-alpha). |
| Pubmed ID | 17107561 |
| Domain | CDD:412663 |
| Functional Category | Others |
| Uniprot ID | A0M1H4 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 44
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1546904 | 1547197 | - | NC_008571.1 | Gramella forsetii KT0803 |
| 2 | 3143090 | 3143380 | - | NZ_CP028136.1 | Gramella fulva |
| 3 | 931481 | 931774 | + | NZ_CP018153.1 | Gramella salexigens |
| 4 | 3523646 | 3523936 | - | NZ_CP016359.1 | Gramella flava JLT2011 |
| 5 | 2786561 | 2786848 | - | NC_014041.1 | Zunongwangia profunda SM-A87 |
| 6 | 40050 | 40337 | - | NZ_CP040812.1 | Antarcticibacterium flavum |
| 7 | 1079455 | 1079742 | + | NZ_CP042476.1 | Antarcticibacterium arcticum |
| 8 | 3280686 | 3280973 | - | NZ_CP058595.1 | Costertonia aggregata |
| 9 | 3351712 | 3351999 | - | NC_014934.1 | Cellulophaga algicola DSM 14237 |
| 10 | 2431338 | 2431622 | + | NC_014230.1 | Croceibacter atlanticus HTCC2559 |
| 11 | 2355635 | 2355916 | - | NC_018013.1 | Aequorivita sublithincola DSM 14238 |
| 12 | 2705812 | 2706099 | - | NZ_CP009976.1 | Cellulophaga baltica 18 |
| 13 | 619037 | 619324 | + | NC_015844.1 | Zobellia galactanivorans |
| 14 | 212862 | 213149 | + | NC_018721.1 | Psychroflexus torquis ATCC 700755 |
| 15 | 2096679 | 2096969 | - | NC_013222.1 | Robiginitalea biformata HTCC2501 |
| 16 | 3408653 | 3408940 | - | NZ_CP022957.1 | Maribacter cobaltidurans |
| 17 | 876909 | 877196 | + | NZ_CP019342.1 | Nonlabens tegetincola |
| 18 | 3444481 | 3444774 | - | NZ_CP025938.1 | Tamlana carrageenivorans |
| 19 | 875802 | 876095 | + | NZ_CP012898.1 | Algibacter alginicilyticus |
| 20 | 2126927 | 2127214 | + | NZ_CP053348.1 | Winogradskyella forsetii |
| 21 | 2080267 | 2080518 | + | NZ_CP053351.1 | Winogradskyella schleiferi |
| 22 | 3715605 | 3715898 | + | NZ_CP039456.1 | Changchengzhania lutea |
| 23 | 2826243 | 2826530 | + | NZ_CP053352.1 | Winogradskyella helgolandensis |
| 24 | 1840142 | 1840429 | + | NZ_CP034549.1 | Nonlabens ponticola |
| 25 | 1936507 | 1936794 | - | NZ_CP032050.1 | Euzebyella marina |
| 26 | 2498370 | 2498666 | - | NZ_CP007202.1 | Siansivirga zeaxanthinifaciens CC-SAMT-1 |
| 27 | 2686020 | 2686313 | - | NZ_CP061703.1 | Mesoflavibacter profundi |
| 28 | 2617964 | 2618248 | + | NZ_CP011071.1 | Muricauda lutaonensis |
| 29 | 3214504 | 3214761 | + | NZ_CP041637.1 | Formosa sediminum |
| 30 | 3599679 | 3599966 | - | NC_020156.1 | Nonlabens dokdonensis DSW-6 |
| 31 | 367928 | 368218 | + | NZ_CP025791.1 | Flavivirga eckloniae |
| 32 | 2937170 | 2937451 | + | NZ_CP015125.1 | Dokdonia donghaensis DSW-1 |
| 33 | 302809 | 303096 | + | NC_015167.1 | Cellulophaga lytica DSM 7489 |
| 34 | 1485866 | 1486111 | - | NZ_CP019352.1 | Lacinutrix venerupis |
| 35 | 363753 | 364049 | - | NZ_CP017477.1 | Polaribacter vadi |
| 36 | 506041 | 506337 | - | NZ_CP061813.1 | Polaribacter haliotis |
| 37 | 2759797 | 2760087 | - | NZ_CP019419.1 | Polaribacter reichenbachii |
| 38 | 3036434 | 3036721 | - | NZ_CP030104.1 | Flagellimonas maritima |
| 39 | 2696765 | 2697010 | - | NC_015945.1 | Muricauda ruestringensis DSM 13258 |
| 40 | 2651408 | 2651683 | + | NZ_CP038810.1 | Flavobacterium sangjuense |
| 41 | 2997929 | 2998225 | - | NZ_CP019044.1 | Salaquimonas pukyongi |
| 42 | 16679 | 16972 | - | NZ_CP011568.3 | Pandoraea thiooxydans |
| 43 | 3641762 | 3642028 | + | NZ_CP029451.1 | Sinorhizobium fredii CCBAU 25509 |
| 44 | 2914806 | 2915102 | - | NZ_CP042435.1 | Panacibacter ginsenosidivorans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_008571.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01709.22 | 0.68 | 30 | 108.5 | same-strand | Transcriptional regulator |
| 2 | PF01571.23 | 0.73 | 32 | 1002.5 | same-strand | Aminomethyltransferase folate-binding domain |
| 3 | PF08669.13 | 0.73 | 32 | 1002.5 | same-strand | Glycine cleavage T-protein C-terminal barrel domain |
++ More..