Protein Information |
Information Type | Description |
---|---|
Protein name | EXP00179 |
NCBI Accession ID | NC_000913.3 |
Organism | Escherichia coli str. K-12 substr. MG1655 |
Left | 851129 |
Right | 851269 |
Strand | + |
Nucleotide Sequence | ATGTTAATTTCCTTCGCTTTAATCCCCGTCCACTGGGAGAAAAAGCCTAAGAAGTCATTGGCTGAGCGGCGGGCTTTAATCACACGATGCGCTTTATCGTCGCTGGAAATGACCATAAAAGGCACCTGGAAATTTTGCTGA |
Sequence | MLISFALIPVHWEKKPKKSLAERRALITRCALSSLEMTIKGTWKFC |
Source of smORF | Ribo-seq |
Function | |
Pubmed ID | 30904393 27013550 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 46 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 851129 | 851269 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
2 | 2885071 | 2885211 | + | NZ_CP061527.1 | Shigella dysenteriae |
3 | 975436 | 975576 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
4 | 1495508 | 1495648 | + | NZ_LR134340.1 | Escherichia marmotae |
5 | 795187 | 795330 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
6 | 4377680 | 4377826 | + | NZ_CP033744.1 | Citrobacter freundii |
7 | 734300 | 734446 | - | NZ_CP044098.1 | Citrobacter portucalensis |
8 | 3633901 | 3634056 | - | NZ_CP041247.1 | Raoultella electrica |
9 | 91878 | 92012 | + | NZ_CP038469.1 | Citrobacter tructae |
10 | 2705805 | 2705924 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
11 | 3151166 | 3151294 | - | NZ_CP035129.1 | Kosakonia cowanii |
12 | 3588526 | 3588645 | - | NZ_LR134475.1 | Klebsiella aerogenes |
13 | 1782810 | 1782926 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
14 | 347414 | 347542 | + | NZ_CP023529.1 | Lelliottia amnigena |
15 | 3147762 | 3147881 | - | NZ_CP045845.1 | Kluyvera intermedia |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00497.22 | 0.86 | 12 | 3125 | opposite-strand | Bacterial extracellular solute-binding proteins, family 3 |
2 | PF00210.26 | 0.93 | 13 | 2224.5 | opposite-strand | Ferritin-like domain |
3 | PF00892.22 | 0.93 | 13 | 1067.5 | opposite-strand | EamA-like transporter family |
4 | PF13505.8 | 0.93 | 13 | 196.5 | same-strand | Outer membrane protein beta-barrel domain |
5 | PF00884.25 | 1.0 | 14 | -140 | opposite-strand | Sulfatase |
6 | PF01325.21 | 0.93 | 13 | 1914.0 | same-strand | Iron dependent repressor, N-terminal DNA binding domain |
7 | PF03600.18 | 0.86 | 12 | 2378 | same-strand | Citrate transporter |