Protein Information |
Information Type | Description |
---|---|
Protein name | DNA gyrase inhibitor YacG |
NCBI Accession ID | CP000931.1 |
Organism | Shewanella halifaxensis (strain HAW-EB4) |
Left | 552783 |
Right | 553022 |
Strand | - |
Nucleotide Sequence | ATGTCTTTAACCGTAAAATGCCCAACATGCCAAGCACCTGTAACTTGGAGTGCTGACTCTGAATTTAAGCCTTTTTGCAGTGAGCGTTGTAAACTGATCGATCTTGGAGATTGGGCGTCAGAGAAAAATGTTATTCCAGTCAAATCTGAGTTCGATCCTGAGATGCTAGATCAATTAGGTTATGATGAAGCCGATTTTTTCCTTGATGAAAATCCTTTTAAGGATGACAAAAACCAATGA |
Sequence | MSLTVKCPTCQAPVTWSADSEFKPFCSERCKLIDLGDWASEKNVIPVKSEFDPEMLDQLGYDEADFFLDENPFKDDKNQ |
Source of smORF | Swiss-Prot |
Function | Inhibits all the catalytic activities of DNA gyrase by preventing its interaction with DNA. Acts by binding directly to the C-terminal domain of GyrB, which probably disrupts DNA binding by the gyrase. {ECO:0000255|HAMAP-Rule:MF_00649}. |
Pubmed ID | |
Domain | CDD:412768 |
Functional Category | Metal-binding |
Uniprot ID | B0TQP7 |
ORF Length (Amino Acid) | 79 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 552783 | 553022 | - | NC_010334.1 | Shewanella halifaxensis HAW-EB4 |
2 | 501340 | 501579 | - | NC_009901.1 | Shewanella pealeana ATCC 700345 |
3 | 4995633 | 4995869 | + | NC_011566.1 | Shewanella piezotolerans WP3 |
4 | 512773 | 512985 | - | NC_009831.1 | Shewanella sediminis HAW-EB3 |
5 | 4110757 | 4110969 | + | NC_009092.1 | Shewanella loihica PV-4 |
6 | 4599187 | 4599402 | - | NZ_CP020373.1 | Shewanella khirikhana |
7 | 442313 | 442528 | - | NC_008700.1 | Shewanella amazonensis SB2B |
8 | 3838625 | 3838837 | + | NZ_CP022272.1 | Shewanella marisflavi |
9 | 4470055 | 4470267 | + | NZ_CP046378.1 | Shewanella algae |
10 | 377398 | 377613 | - | NZ_CP069213.1 | Shewanella litorisediminis |
11 | 369377 | 369589 | - | NC_010506.1 | Shewanella woodyi ATCC 51908 |
12 | 4289821 | 4290030 | + | NZ_CP022358.1 | Shewanella bicestrii |
13 | 6065445 | 6065657 | + | NZ_CP014782.1 | Shewanella psychrophila |
14 | 4746127 | 4746336 | + | NC_016901.1 | Shewanella baltica OS678 |
15 | 3665606 | 3665815 | - | NZ_CP041783.1 | Shewanella donghaensis |
16 | 298719 | 298931 | - | NC_014012.1 | Shewanella violacea DSS12 |
17 | 458913 | 459122 | - | NZ_CP020472.1 | Shewanella japonica |
18 | 5102593 | 5102808 | + | NZ_CP037952.1 | Parashewanella spongiae |
19 | 3985607 | 3985819 | + | NZ_CP037951.1 | Parashewanella tropica |
20 | 4365454 | 4365666 | + | NZ_CP041036.1 | Shewanella polaris |
21 | 2665850 | 2666077 | - | NZ_CP036200.1 | Shewanella maritima |
22 | 634725 | 634937 | - | NZ_CP034015.1 | Shewanella livingstonensis |
23 | 4049249 | 4049473 | + | NC_007954.1 | Shewanella denitrificans OS217 |
24 | 3865108 | 3865317 | - | NZ_CP051180.1 | Ferrimonas lipolytica |
25 | 394071 | 394295 | - | NC_014541.1 | Ferrimonas balearica DSM 9799 |
26 | 4509428 | 4509640 | + | NC_008345.1 | Shewanella frigidimarina NCIMB 400 |
27 | 3191289 | 3191525 | - | NZ_CP034759.1 | Litorilituus sediminis |
28 | 105014 | 105250 | - | NZ_CP020465.1 | Cognaticolwellia beringensis |
29 | 2452352 | 2452570 | - | NZ_CP007142.1 | Gynuella sunshinyii YC6258 |
30 | 2820551 | 2820745 | + | NZ_CP044060.1 | Aeromonas veronii |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF14815.8 | 0.97 | 29 | 9 | same-strand | NUDIX domain |
2 | PF00293.30 | 0.93 | 28 | 10.0 | same-strand | NUDIX domain |
3 | PF07072.13 | 0.97 | 29 | 49 | same-strand | Cell division protein |
4 | PF01121.22 | 1.0 | 30 | 791.5 | same-strand | Dephospho-CoA kinase |
5 | PF06750.15 | 1.0 | 30 | 1420.0 | same-strand | Bacterial Peptidase A24 N-terminal domain |
6 | PF01478.20 | 1.0 | 30 | 1420.0 | same-strand | Type IV leader peptidase family |
7 | PF00482.25 | 0.97 | 29 | 2384 | same-strand | Type II secretion system (T2SS), protein F |
8 | PF00437.22 | 0.9 | 27 | 3744 | same-strand | Type II/IV secretion system protein |
9 | PF05157.17 | 0.87 | 26 | 3747.0 | same-strand | Type II secretion system (T2SS), protein E, N-terminal domain |