Result : EXP00167
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00167 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 906421 |
| Right | 906522 |
| Strand | + |
| Nucleotide Sequence | ATGAATAAAGTTACGCACACCCCAGGCGACAGCCCATTCACCCAGGCGGCGAGTGGCGCGAACGTTAGCCAGATCGAAAGCCTGTTGTGTCCCCCAGGGTGA |
| Sequence | MNKVTHTPGDSPFTQAASGANVSQIESLLCPPG |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 27013550 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 33 |
++ More..
| Conservation Analysis |
No. of Species: 16
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 906421 | 906522 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 855657 | 855758 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 1402893 | 1402994 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 3712798 | 3712911 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 5 | 3536920 | 3537033 | + | NZ_CP026047.1 | Raoultella planticola |
| 6 | 1354913 | 1355014 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 7 | 3546904 | 3547005 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 8 | 3317722 | 3317823 | + | NZ_CP042941.1 | Atlantibacter hermannii |
| 9 | 1652634 | 1652735 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 10 | 3542381 | 3542494 | - | NZ_CP041247.1 | Raoultella electrica |
| 11 | 3437723 | 3437836 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 12 | 3931747 | 3931860 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 13 | 1441874 | 1441987 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 14 | 895906 | 896007 | - | NZ_CP033744.1 | Citrobacter freundii |
| 15 | 3167061 | 3167162 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 16 | 3007952 | 3008053 | + | NZ_CP023706.1 | Edwardsiella tarda |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP045300.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00005.29 | 0.62 | 10 | 2781.5 | opposite-strand | ABC transporter |
| 2 | PF12883.9 | 0.88 | 14 | 2530.5 | opposite-strand | Protein of unknown function (DUF3828) |
| 3 | PF01906.19 | 0.75 | 12 | 1513.5 | same-strand | Putative heavy-metal-binding |
| 4 | PF01510.27 | 1.0 | 16 | 684.0 | same-strand | N-acetylmuramoyl-L-alanine amidase |
| 5 | PF01370.23 | 1.0 | 16 | -101.0 | opposite-strand | NAD dependent epimerase/dehydratase family |
| 6 | PF01073.21 | 1.0 | 16 | -101.0 | opposite-strand | 3-beta hydroxysteroid dehydrogenase/isomerase family |
| 7 | PF16363.7 | 1.0 | 16 | -101.0 | opposite-strand | GDP-mannose 4,6 dehydratase |
| 8 | PF11066.10 | 1.0 | 16 | 325.0 | opposite-strand | Protein of unknown function (DUF2867) |
| 9 | PF01212.23 | 1.0 | 16 | 1771.0 | opposite-strand | Beta-eliminating lyase |
| 10 | PF02776.20 | 0.94 | 15 | 2809 | opposite-strand | Thiamine pyrophosphate enzyme, N-terminal TPP binding domain |
| 11 | PF02775.23 | 0.94 | 15 | 2809 | opposite-strand | Thiamine pyrophosphate enzyme, C-terminal TPP binding domain |
| 12 | PF00205.24 | 0.94 | 15 | 2809 | opposite-strand | Thiamine pyrophosphate enzyme, central domain |
| 13 | PF07681.14 | 0.75 | 12 | 4678.5 | same-strand | DoxX |
| 14 | PF00155.23 | 0.62 | 10 | 1765.5 | opposite-strand | Aminotransferase class I and II |
++ More..