Result : EXP00166
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00166 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 4521482 |
| Right | 4521751 |
| Strand | + |
| Nucleotide Sequence | ATGATACCGTATATCAGTACCAATCCTACATCAGCGCCATATTCCCTGGCGATAACAGTCGGGCCGGGGTGCGGCGGCAAAAAACCGTGTGCGACCAGCAAACCAGAAAGCATCGGCACACACATAAACATCGGTGATATTTTTGCTTCACGGGCAATAGCGAATAAAATAGGTACCAGAAGAATTAAACCGACTTCGAAAAAAAGTGCGATACCGACAATAAACGCCGAACAGACCACTGCCCAGTCAAGTTTATTTTTCCCGAAATAA |
| Sequence | MIPYISTNPTSAPYSLAITVGPGCGGKKPCATSKPESIGTHINIGDIFASRAIANKIGTRRIKPTSKKSAIPTINAEQTTAQSSLFFPK |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 27013550 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 89 |
++ More..
| Conservation Analysis |
No. of Species: 16
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4521482 | 4521751 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 3775094 | 3775363 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 3 | 595211 | 595480 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 4 | 4336190 | 4336447 | + | NZ_CP006569.1 | Sodalis praecaptivus |
| 5 | 2513022 | 2513249 | - | NZ_CP040882.1 | Sutterella faecalis |
| 6 | 2324620 | 2324841 | - | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 7 | 62177 | 62398 | - | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 8 | 3951412 | 3951633 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 9 | 4012192 | 4012410 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 10 | 4116001 | 4116222 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 11 | 1496783 | 1497004 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 12 | 36709 | 36930 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 13 | 552391 | 552681 | - | NZ_CP047361.1 | Macrococcus canis |
| 14 | 2783462 | 2783683 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 15 | 1582184 | 1582456 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 16 | 1003238 | 1003477 | + | NC_018631.1 | Leuconostoc gelidum JB7 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02447.18 | 1.0 | 16 | -224.0 | opposite-strand | GntP family permease |
| 2 | PF03600.18 | 1.0 | 16 | -224.0 | opposite-strand | Citrate transporter |
++ More..