Result : EXP00164
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00164 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 296087 |
| Right | 296212 |
| Strand | + |
| Nucleotide Sequence | ATGATACGTTCACCTTCGATCTTGTCTTTAATTCGCATGCTTGACCATTTGAAATCTACGTCTGACCAGCGAAGCGACGCAATTTCTTCACGCCGAGCACCAGTGAGCAAAAGTACTTGGAGATAG |
| Sequence | MIRSPSILSLIRMLDHLKSTSDQRSDAISSRRAPVSKSTWR |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 27013550 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 41 |
++ More..
| Conservation Analysis |
No. of Species: 15
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 296087 | 296212 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 1167283 | 1167408 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 3 | 3190089 | 3190193 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 4 | 1273787 | 1273912 | + | NC_012691.1 | Tolumonas auensis DSM 9187 |
| 5 | 3084388 | 3084513 | + | NZ_CP028339.1 | Thauera aromatica K172 |
| 6 | 3332859 | 3332984 | - | NZ_CP047241.1 | Aquitalea denitrificans |
| 7 | 2227018 | 2227143 | + | NZ_CP039731.1 | Aquitalea aquatilis |
| 8 | 966279 | 966401 | + | NZ_CP058952.1 | Chitinibacter fontanus |
| 9 | 532129 | 532254 | + | NZ_CP035708.1 | Sphaerotilus natans subsp. sulfidivorans |
| 10 | 131364 | 131483 | + | NC_006513.1 | Aromatoleum aromaticum EbN1 |
| 11 | 1086421 | 1086525 | + | NZ_CP046913.1 | Paraburkholderia acidisoli |
| 12 | 3364285 | 3364413 | - | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 13 | 1678387 | 1678512 | - | NZ_CP045650.1 | Acinetobacter wanghuae |
| 14 | 3257145 | 3257270 | + | NZ_CP007029.1 | Thioalkalivibrio paradoxus ARh 1 |
| 15 | 43306 | 43410 | - | NZ_CP024934.1 | Paraburkholderia graminis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00589.24 | 1.0 | 15 | -125 | opposite-strand | Phage integrase family |
++ More..