Result : EXP00162
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00162 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 4628581 |
| Right | 4628748 |
| Strand | + |
| Nucleotide Sequence | ATGAGTTTTTTTGATGAGTTGAAAACCTCTCTGGAAGAGGCTGTCGAGATTAAACAAGGTTTGAAAAAACCTGCACGGGTGACCCGCCACGAAATTGAGGATGCTAAGGCTGTTGTAGACCGGAAACGGTGTTCACGCCGCATCCGGCATTCGGTGCTCAATGCCTGA |
| Sequence | MSFFDELKTSLEEAVEIKQGLKKPARVTRHEIEDAKAVVDRKRCSRRIRHSVLNA |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 27013550 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 55 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4594186 | 4594353 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 2 | 4628581 | 4628748 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 5485507 | 5485674 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 3627471 | 3627620 | - | NZ_CP061527.1 | Shigella dysenteriae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03099.21 | 1.0 | 3 | 4464.0 | opposite-strand | Biotin/lipoate A/B protein ligase family |
| 2 | PF10144.11 | 1.0 | 3 | 3792.0 | opposite-strand | Bacterial virulence factor haemolysin |
| 3 | PF17152.6 | 1.0 | 3 | 3792.0 | opposite-strand | Periplasmic sensor domain |
| 4 | PF18429.3 | 1.0 | 3 | 2718.0 | same-strand | Domain of unknown function (DUF5609) |
| 5 | PF12710.9 | 1.0 | 3 | 2718.0 | same-strand | haloacid dehalogenase-like hydrolase |
| 6 | PF00702.28 | 1.0 | 3 | 2718.0 | same-strand | haloacid dehalogenase-like hydrolase |
| 7 | PF13481.8 | 1.0 | 3 | 1287.0 | same-strand | AAA domain |
| 8 | PF18073.3 | 1.0 | 3 | 1287.0 | same-strand | Rubredoxin metal binding domain |
| 9 | PF13521.8 | 1.0 | 3 | 34.0 | same-strand | AAA domain |
| 10 | PF01381.24 | 1.0 | 3 | 34 | same-strand | Helix-turn-helix |
| 11 | PF12844.9 | 1.0 | 3 | 34 | same-strand | Helix-turn-helix domain |
| 12 | PF00005.29 | 1.0 | 3 | 107.0 | opposite-strand | ABC transporter |
| 13 | PF12848.9 | 1.0 | 3 | 107.0 | opposite-strand | ABC transporter |
| 14 | PF01464.22 | 1.0 | 3 | 1985.0 | same-strand | Transglycosylase SLT domain |
| 15 | PF14718.8 | 1.0 | 3 | 1985.0 | same-strand | Soluble lytic murein transglycosylase L domain |
| 16 | PF01371.21 | 1.0 | 3 | 4042.0 | same-strand | Trp repressor protein |
| 17 | PF00300.24 | 1.0 | 3 | 5022.0 | same-strand | Histidine phosphatase superfamily (branch 1) |
| 18 | PF10437.11 | 0.67 | 2 | 4464 | opposite-strand | Bacterial lipoate protein ligase C-terminus |
| 19 | PF01931.20 | 0.67 | 2 | 4485 | opposite-strand | Protein of unknown function DUF84 |
++ More..