Result : EXP00161
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00161 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 3754611 |
| Right | 3754754 |
| Strand | + |
| Nucleotide Sequence | ATGAATAACTCCAGTAAAACATCCACAGTACAGATTAAGCGTATTAAACCTTCAATTATCTACCGTTTATTGCTGATTGGCCTCGGATCACCAATGGTGATTTACGGCCTGGTTCGCCCGCTCACCATCGAAACGCGAGATTAA |
| Sequence | MNNSSKTSTVQIKRIKPSIIYRLLLIGLGSPMVIYGLVRPLTIETRD |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 27013550 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 47 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3728907 | 3729050 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 2 | 3754611 | 3754754 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 4496069 | 4496212 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_004337.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00171.24 | 1.0 | 2 | 219 | opposite-strand | Aldehyde dehydrogenase family |
| 2 | PF00465.21 | 1.0 | 2 | 1922 | opposite-strand | Iron-containing alcohol dehydrogenase |
| 3 | PF00009.29 | 1.0 | 2 | 3263 | opposite-strand | Elongation factor Tu GTP binding domain |
| 4 | PF09107.13 | 1.0 | 2 | 3263 | opposite-strand | Elongation factor SelB, winged helix |
| 5 | PF09106.13 | 1.0 | 2 | 3263 | opposite-strand | Elongation factor SelB, winged helix |
| 6 | PF03144.27 | 1.0 | 2 | 3263 | opposite-strand | Elongation factor Tu domain 2 |
| 7 | PF01926.25 | 1.0 | 2 | 3263 | opposite-strand | 50S ribosome-binding GTPase |
| 8 | PF03841.15 | 1.0 | 2 | 5104 | opposite-strand | L-seryl-tRNA selenium transferase |
| 9 | PF12390.10 | 1.0 | 2 | 5104 | opposite-strand | Selenocysteine synthase N terminal |
| 10 | PF13417.8 | 1.0 | 2 | 6593.0 | opposite-strand | Glutathione S-transferase, N-terminal domain |
| 11 | PF00043.27 | 1.0 | 2 | 6593.0 | opposite-strand | Glutathione S-transferase, C-terminal domain |
| 12 | PF13409.8 | 1.0 | 2 | 6593.0 | opposite-strand | Glutathione S-transferase, N-terminal domain |
| 13 | PF02798.22 | 1.0 | 2 | 6593.0 | opposite-strand | Glutathione S-transferase, N-terminal domain |
++ More..