Result : B0TPU5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
| NCBI Accession ID | CP000931.1 |
| Organism | Shewanella halifaxensis (strain HAW-EB4) |
| Left | 458554 |
| Right | 458835 |
| Strand | - |
| Nucleotide Sequence | ATGGCTCGCGTAACTGTAGAAGATGCCGTAAACCAAATCGGCAACCGTTTTGATATGATTCTGGTTGCAGCGCGTCGTGCTCGCCAAATCGCTGTGCAGGGTAAAGACCCTATGGTTGAAGAAGAGAACGACAAACCAACGGTTATCGCCCTGCGCGAAATCGAACTAGGTTTAGTCACAGCTGATACTTTGGATGCCGATGAGCGCCAAACAGTTCGTGAACGTGAAGCAGCTGAAATCGCTGCTGTTGCTGCCATCGCTGAAGGCCGTAACGCAATATAA |
| Sequence | MARVTVEDAVNQIGNRFDMILVAARRARQIAVQGKDPMVEEENDKPTVIALREIELGLVTADTLDADERQTVREREAAEIAAVAAIAEGRNAI |
| Source of smORF | Swiss-Prot |
| Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
| Pubmed ID | |
| Domain | CDD:417484 |
| Functional Category | Others |
| Uniprot ID | B0TPU5 |
| ORF Length (Amino Acid) | 93 |
++ More..
| Conservation Analysis |
No. of Species: 251
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3910449 | 3910730 | + | NZ_CP022272.1 | Shewanella marisflavi |
| 2 | 458554 | 458835 | - | NC_010334.1 | Shewanella halifaxensis HAW-EB4 |
| 3 | 4184353 | 4184634 | + | NC_009092.1 | Shewanella loihica PV-4 |
| 4 | 324657 | 324938 | - | NC_011566.1 | Shewanella piezotolerans WP3 |
| 5 | 4677368 | 4677652 | + | NC_014012.1 | Shewanella violacea DSS12 |
| 6 | 4723845 | 4724129 | + | NC_009901.1 | Shewanella pealeana ATCC 700345 |
| 7 | 389159 | 389443 | - | NC_009831.1 | Shewanella sediminis HAW-EB3 |
| 8 | 3815704 | 3815988 | + | NZ_CP014782.1 | Shewanella psychrophila |
| 9 | 5553465 | 5553749 | + | NC_010506.1 | Shewanella woodyi ATCC 51908 |
| 10 | 406725 | 407003 | - | NC_016901.1 | Shewanella baltica OS678 |
| 11 | 4103367 | 4103645 | + | NC_007954.1 | Shewanella denitrificans OS217 |
| 12 | 1689923 | 1690198 | - | NZ_CP019706.1 | Pantoea alhagi |
| 13 | 211512 | 211787 | - | NZ_FO704551.1 | Xenorhabdus poinarii G6 |
| 14 | 98807 | 99082 | - | NZ_LR134531.1 | Pragia fontium |
| 15 | 65958 | 66233 | - | NZ_LS483470.1 | Leminorella richardii |
| 16 | 240702 | 240974 | + | NC_016041.1 | Glaciecola nitratireducens FR1064 |
| 17 | 178442 | 178717 | - | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 18 | 75180 | 75455 | - | NC_013961.1 | Erwinia amylovora CFBP1430 |
| 19 | 3930093 | 3930368 | + | NZ_CP023567.1 | Erwinia pyrifoliae |
| 20 | 65797 | 66072 | - | NC_010694.1 | Erwinia tasmaniensis Et1/99 |
| 21 | 143739 | 144014 | - | NZ_CP071325.1 | Photobacterium ganghwense |
| 22 | 60300 | 60575 | - | NC_014306.1 | Erwinia billingiae Eb661 |
| 23 | 491688 | 491963 | - | NZ_CP005974.1 | Photobacterium gaetbulicola Gung47 |
| 24 | 3523711 | 3523986 | - | NZ_CP016176.1 | Xenorhabdus hominickii |
| 25 | 4467580 | 4467855 | - | NZ_CP015581.1 | Tatumella citrea |
| 26 | 471793 | 472068 | - | NZ_CP070624.1 | Photobacterium damselae subsp. damselae |
| 27 | 192752 | 193027 | - | NZ_CP029185.2 | Limnobaculum parvum |
| 28 | 3792421 | 3792696 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 29 | 169949 | 170224 | - | NZ_CP028897.1 | Dongshaea marina |
| 30 | 4126263 | 4126538 | - | NZ_CP031123.2 | Providencia huaxiensis |
| 31 | 251679 | 251951 | + | NC_011312.1 | Aliivibrio salmonicida LFI1238 |
| 32 | 195728 | 196012 | - | NC_012691.1 | Tolumonas auensis DSM 9187 |
| 33 | 235788 | 236063 | - | NC_013892.1 | Xenorhabdus bovienii SS-2004 |
| 34 | 3230977 | 3231249 | + | NZ_LT960611.1 | Vibrio tapetis subsp. tapetis |
| 35 | 2674862 | 2675149 | - | NZ_CP034759.1 | Litorilituus sediminis |
| 36 | 99828 | 100106 | - | NZ_CP031416.1 | Gallaecimonas mangrovi |
| 37 | 150522 | 150794 | + | NZ_CP008849.1 | Alteromonas australica |
| 38 | 91787 | 92059 | + | NZ_CP046670.1 | Alteromonas mediterranea |
| 39 | 5282251 | 5282538 | + | NC_003910.7 | Colwellia psychrerythraea 34H |
| 40 | 3092619 | 3092894 | + | NZ_CP029347.1 | Saliniradius amylolyticus |
| 41 | 4099598 | 4099870 | - | NC_015554.1 | Alteromonas naphthalenivorans |
| 42 | 2088705 | 2088980 | - | NZ_CP020465.1 | Cognaticolwellia beringensis |
| 43 | 200088 | 200360 | + | NZ_CP014322.1 | Alteromonas addita |
| 44 | 522819 | 523100 | + | NZ_CP022355.1 | Paraphotobacterium marinum |
| 45 | 241846 | 242118 | - | NZ_AP018689.1 | Vibrio aphrogenes |
| 46 | 123657 | 123929 | - | NZ_CP040021.1 | Salinivibrio kushneri |
| 47 | 285036 | 285308 | - | NZ_AP018685.1 | Vibrio rumoiensis |
| 48 | 4473028 | 4473303 | + | NZ_CP026377.1 | Mixta gaviniae |
| 49 | 3791469 | 3791744 | + | NZ_AP014857.1 | Escherichia albertii |
| 50 | 2311455 | 2311727 | + | NZ_CP052766.1 | Alteromonas pelagimontana |
| 51 | 112639 | 112914 | - | NZ_CP034148.1 | Pantoea agglomerans |
| 52 | 118549 | 118824 | - | NZ_CP045720.1 | Pantoea eucalypti |
| 53 | 121398 | 121673 | - | NZ_CP038853.1 | Pantoea vagans |
| 54 | 2951546 | 2951821 | - | NZ_CP049115.1 | Pantoea stewartii |
| 55 | 130409 | 130684 | - | NC_017554.1 | Pantoea ananatis PA13 |
| 56 | 929008 | 929274 | + | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
| 57 | 1771193 | 1771462 | - | NZ_CP016605.1 | Bisgaardia hudsonensis |
| 58 | 3676916 | 3677191 | + | NZ_CP028271.1 | Mixta intestinalis |
| 59 | 1062832 | 1063098 | - | NZ_CP040863.1 | Rodentibacter heylii |
| 60 | 2239279 | 2239545 | + | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
| 61 | 144379 | 144654 | - | NZ_CP017689.1 | Thalassotalea crassostreae |
| 62 | 4440470 | 4440745 | + | NC_008709.1 | Psychromonas ingrahamii 37 |
| 63 | 190550 | 190822 | + | NZ_CP036536.1 | Salinimonas lutimaris |
| 64 | 4665750 | 4666025 | + | NZ_CP006569.1 | Sodalis praecaptivus |
| 65 | 4167408 | 4167683 | + | NZ_CP061511.1 | Mixta calida |
| 66 | 3905885 | 3906160 | + | NZ_CP034035.1 | Brenneria rubrifaciens |
| 67 | 1352110 | 1352382 | - | NZ_LT906448.1 | Pasteurella dagmatis |
| 68 | 1340604 | 1340870 | - | NZ_CP015031.1 | Basfia succiniciproducens |
| 69 | 1728249 | 1728515 | - | NC_006300.1 | [Mannheimia] succiniciproducens MBEL55E |
| 70 | 1636688 | 1636963 | + | NZ_CP042941.1 | Atlantibacter hermannii |
| 71 | 2114881 | 2115147 | - | NZ_LR134167.1 | Avibacterium volantium |
| 72 | 52226 | 52501 | - | NZ_LN907827.1 | Erwinia gerundensis |
| 73 | 4732151 | 4732426 | + | NZ_CP034036.1 | Brenneria nigrifluens DSM 30175 = ATCC 13028 |
| 74 | 242454 | 242729 | + | NZ_CP072455.1 | Xenorhabdus budapestensis |
| 75 | 4022603 | 4022878 | + | NZ_FO704550.1 | Xenorhabdus doucetiae |
| 76 | 3615096 | 3615371 | + | NZ_CP060401.1 | Xenorhabdus nematophila |
| 77 | 4465623 | 4465898 | + | NZ_AP023184.1 | Buttiauxella agrestis |
| 78 | 320380 | 320661 | + | NZ_CP006944.1 | Mannheimia varigena USDA-ARS-USMARC-1312 |
| 79 | 230136 | 230417 | - | NZ_CP061280.1 | Mannheimia bovis |
| 80 | 406171 | 406452 | + | NC_021883.1 | Mannheimia haemolytica USMARC_2286 |
| 81 | 96984 | 97259 | - | NZ_CP041247.1 | Raoultella electrica |
| 82 | 112036 | 112311 | - | NZ_CP050508.1 | Raoultella terrigena |
| 83 | 4257705 | 4257977 | - | NZ_CP031769.1 | Salinimonas sediminis |
| 84 | 1603574 | 1603849 | + | NZ_CP026047.1 | Raoultella planticola |
| 85 | 118689 | 118964 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 86 | 4154077 | 4154352 | + | NZ_CP014137.1 | Brenneria goodwinii |
| 87 | 2053259 | 2053537 | + | NZ_CP021376.1 | Oceanisphaera avium |
| 88 | 738675 | 738950 | + | NZ_CP023536.1 | Providencia alcalifaciens |
| 89 | 3566183 | 3566458 | + | NZ_CP067057.1 | Rahnella aceris |
| 90 | 366148 | 366423 | - | NZ_LS483422.1 | Providencia heimbachae |
| 91 | 4685571 | 4685846 | + | NZ_CP038498.1 | Pectobacterium punjabense |
| 92 | 1519498 | 1519773 | + | NZ_CP047495.1 | Pectobacterium brasiliense |
| 93 | 4791135 | 4791410 | + | NZ_CP051652.1 | Pectobacterium carotovorum |
| 94 | 4890321 | 4890596 | + | NZ_CP065044.1 | Pectobacterium aroidearum |
| 95 | 4901477 | 4901752 | + | NZ_CP034938.1 | Pectobacterium odoriferum |
| 96 | 3811963 | 3812238 | - | NZ_CP017482.1 | Pectobacterium polaris |
| 97 | 4192679 | 4192954 | - | NZ_CP015749.1 | Pectobacterium parmentieri |
| 98 | 1784662 | 1784937 | - | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
| 99 | 76103 | 76378 | - | NZ_CP042220.2 | Dickeya poaceiphila |
| 100 | 4587243 | 4587518 | + | NZ_LR134201.1 | Cedecea lapagei |
| 101 | 4987931 | 4988206 | + | NZ_CP023525.1 | Cedecea neteri |
| 102 | 4626533 | 4626808 | + | NZ_CP025799.1 | Dickeya zeae |
| 103 | 4677895 | 4678170 | + | NC_012912.1 | Dickeya chrysanthemi Ech1591 |
| 104 | 5215354 | 5215629 | + | NZ_CP048784.1 | Serratia liquefaciens |
| 105 | 5288496 | 5288771 | + | NZ_LR134494.1 | Serratia quinivorans |
| 106 | 5357838 | 5358113 | + | NC_015567.1 | Serratia plymuthica AS9 |
| 107 | 1857371 | 1857643 | - | NZ_CP018804.1 | Histophilus somni |
| 108 | 4397999 | 4398274 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 109 | 1032569 | 1032844 | + | NZ_CP023009.1 | Lonsdalea britannica |
| 110 | 46247 | 46522 | - | NZ_LT615367.1 | Dickeya aquatica |
| 111 | 2431626 | 2431874 | + | NZ_CP025120.1 | Kangiella profundi |
| 112 | 49955 | 50230 | - | NZ_CP009125.1 | Pectobacterium atrosepticum |
| 113 | 509451 | 509726 | + | NZ_CP029736.1 | Providencia rettgeri |
| 114 | 58480 | 58755 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 115 | 572574 | 572849 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 116 | 4732245 | 4732520 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 117 | 1845127 | 1845393 | - | NZ_LS483429.1 | Haemophilus aegyptius |
| 118 | 3742047 | 3742322 | + | NZ_CP065534.1 | Lonsdalea populi |
| 119 | 1100275 | 1100541 | + | NZ_CP009610.1 | Haemophilus influenzae |
| 120 | 45368 | 45643 | - | NC_014500.1 | Dickeya dadantii 3937 |
| 121 | 2911100 | 2911375 | - | NZ_CP009460.1 | Dickeya fangzhongdai |
| 122 | 1148249 | 1148515 | + | NZ_LS483458.1 | Haemophilus haemolyticus |
| 123 | 3603360 | 3603635 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 124 | 169244 | 169519 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 125 | 155450 | 155725 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 126 | 306172 | 306447 | - | NZ_CP048796.1 | Providencia vermicola |
| 127 | 3493459 | 3493734 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 128 | 4038962 | 4039237 | + | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 129 | 4199732 | 4200007 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 130 | 4276228 | 4276503 | + | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 131 | 4120566 | 4120841 | - | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 132 | 4176058 | 4176333 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 133 | 4371270 | 4371545 | + | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 134 | 53249 | 53524 | - | NZ_LR134340.1 | Escherichia marmotae |
| 135 | 2335744 | 2336019 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 136 | 1762343 | 1762618 | + | NZ_CP053416.1 | Salmonella bongori |
| 137 | 2966486 | 2966761 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 138 | 88838 | 89113 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 139 | 3822106 | 3822381 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 140 | 4506255 | 4506530 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 141 | 81655 | 81930 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 142 | 4686350 | 4686625 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 143 | 98395 | 98670 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 144 | 100552 | 100827 | - | NC_015968.1 | Enterobacter soli |
| 145 | 2504681 | 2504956 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 146 | 117140 | 117415 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 147 | 3324861 | 3325136 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 148 | 3933788 | 3934063 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 149 | 3439461 | 3439736 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 150 | 2511230 | 2511505 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 151 | 2567229 | 2567504 | + | NZ_CP033744.1 | Citrobacter freundii |
| 152 | 1267591 | 1267866 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 153 | 102580 | 102855 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 154 | 1261947 | 1262222 | - | NZ_CP040428.1 | Jejubacter calystegiae |
| 155 | 109734 | 110009 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 156 | 108169 | 108444 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 157 | 5181494 | 5181769 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 158 | 1005372 | 1005647 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
| 159 | 352198 | 352473 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 160 | 4566093 | 4566368 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 161 | 106058 | 106333 | - | NZ_CP054254.1 | Klebsiella variicola |
| 162 | 1920412 | 1920690 | - | NZ_CP021377.1 | Oceanisphaera profunda |
| 163 | 2865968 | 2866240 | + | NZ_AP019651.1 | Vibrio taketomensis |
| 164 | 2997026 | 2997298 | - | NZ_AP019657.1 | Vibrio ponticus |
| 165 | 107780 | 108061 | - | NZ_CP046531.1 | Mannheimia ovis |
| 166 | 107901 | 108182 | - | NZ_CP055305.1 | Mannheimia pernigra |
| 167 | 2625138 | 2625386 | - | NC_013166.1 | Kangiella koreensis DSM 16069 |
| 168 | 21164 | 21439 | - | NZ_CP071320.1 | Serratia ureilytica |
| 169 | 4380328 | 4380603 | + | NZ_CP016948.1 | Serratia surfactantfaciens |
| 170 | 5120970 | 5121245 | + | NZ_LT906479.1 | Serratia ficaria |
| 171 | 5171930 | 5172205 | + | NZ_CP038662.1 | Serratia nematodiphila |
| 172 | 75119 | 75394 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 173 | 3025687 | 3025962 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 174 | 4771012 | 4771287 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 175 | 3235647 | 3235922 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 176 | 87665 | 87940 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 177 | 5229043 | 5229318 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 178 | 188621 | 188890 | - | NZ_CP028926.1 | Pasteurella multocida |
| 179 | 105647 | 105919 | - | NZ_CP022741.1 | Vibrio qinghaiensis |
| 180 | 4788261 | 4788536 | + | NZ_CP031560.1 | Dickeya dianthicola |
| 181 | 2045472 | 2045747 | + | NZ_CP015137.1 | Dickeya solani IPO 2222 |
| 182 | 1419166 | 1419441 | + | NZ_CP065640.1 | Serratia rubidaea |
| 183 | 155690 | 155962 | - | NC_011753.2 | Vibrio atlanticus |
| 184 | 3173513 | 3173785 | + | NZ_CP039700.1 | Vibrio cyclitrophicus |
| 185 | 3672441 | 3672716 | + | NZ_CP047349.1 | Proteus terrae subsp. cibarius |
| 186 | 3140640 | 3140915 | + | NC_010554.1 | Proteus mirabilis HI4320 |
| 187 | 4057762 | 4058037 | + | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 188 | 154363 | 154638 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 189 | 3508342 | 3508617 | - | NZ_CP038469.1 | Citrobacter tructae |
| 190 | 2052374 | 2052646 | - | NZ_CP046793.1 | Vibrio metschnikovii |
| 191 | 310522 | 310794 | - | NZ_CP044069.1 | Vibrio vulnificus |
| 192 | 4697051 | 4697326 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 193 | 44157 | 44432 | - | NZ_CP050150.1 | Hafnia alvei |
| 194 | 2963726 | 2963998 | - | NZ_CP014035.2 | Vibrio fluvialis |
| 195 | 250613 | 250885 | + | NZ_CP040990.1 | Vibrio furnissii |
| 196 | 1289785 | 1290060 | + | NZ_CP026364.1 | Proteus hauseri |
| 197 | 1014569 | 1014844 | - | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
| 198 | 1676578 | 1676853 | + | NZ_CP011254.1 | Serratia fonticola |
| 199 | 1171666 | 1171935 | + | NZ_LR134510.1 | Actinobacillus delphinicola |
| 200 | 2199720 | 2199995 | + | NZ_CP011078.1 | Yersinia ruckeri |
| 201 | 2944340 | 2944615 | - | NZ_CP009787.1 | Yersinia rohdei |
| 202 | 2626049 | 2626324 | + | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 203 | 4526040 | 4526315 | + | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 204 | 54646 | 54921 | - | NZ_CP043727.1 | Yersinia canariae |
| 205 | 4639971 | 4640246 | + | NZ_CP011118.1 | Yersinia enterocolitica |
| 206 | 58265 | 58540 | - | NZ_CP032487.1 | Yersinia hibernica |
| 207 | 1673422 | 1673697 | - | NZ_CP007230.1 | Yersinia similis |
| 208 | 4638530 | 4638805 | + | NZ_CP046293.1 | Yersinia intermedia |
| 209 | 228606 | 228881 | - | NC_012962.1 | Photorhabdus asymbiotica |
| 210 | 2180781 | 2181056 | - | NZ_CP011104.1 | Photorhabdus thracensis |
| 211 | 290628 | 290903 | - | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 212 | 1772399 | 1772674 | - | NZ_CP023706.1 | Edwardsiella tarda |
| 213 | 36207 | 36482 | - | NZ_CP016043.1 | Edwardsiella hoshinae |
| 214 | 1805701 | 1805976 | - | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
| 215 | 2960169 | 2960441 | + | NZ_CP032093.1 | Vibrio alfacsensis |
| 216 | 2744927 | 2745199 | + | NZ_CP009977.1 | Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759 |
| 217 | 252653 | 252925 | + | NC_013456.1 | Vibrio antiquarius |
| 218 | 162802 | 163074 | - | NZ_CP030788.1 | Vibrio campbellii |
| 219 | 3094360 | 3094632 | + | NZ_CP031781.1 | Vibrio parahaemolyticus |
| 220 | 2944845 | 2945117 | + | NZ_CP018312.1 | Vibrio rotiferianus |
| 221 | 1651036 | 1651308 | + | NZ_CP019959.1 | Vibrio owensii |
| 222 | 377202 | 377474 | - | NZ_CP009467.1 | Vibrio harveyi |
| 223 | 2062186 | 2062458 | + | NZ_CP025792.1 | Vibrio jasicida 090810c |
| 224 | 1308265 | 1308537 | + | NZ_CP065150.1 | Vibrio kanaloae |
| 225 | 2553700 | 2553969 | - | NC_006512.1 | Idiomarina loihiensis L2TR |
| 226 | 4575916 | 4576191 | + | NC_012880.1 | Musicola paradisiaca Ech703 |
| 227 | 171598 | 171846 | - | NZ_CP010975.1 | Kangiella geojedonensis |
| 228 | 623818 | 624099 | - | NZ_CP015029.1 | Frederiksenia canicola |
| 229 | 2090914 | 2091195 | - | NZ_CP030753.1 | Actinobacillus pleuropneumoniae |
| 230 | 2151433 | 2151699 | - | NZ_LT906463.1 | Haemophilus pittmaniae |
| 231 | 30766 | 31041 | - | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 232 | 1862165 | 1862446 | + | NZ_CP009159.1 | Actinobacillus suis ATCC 33415 |
| 233 | 2592463 | 2592738 | - | NZ_CP014136.1 | Gibbsiella quercinecans |
| 234 | 157303 | 157584 | + | NZ_CP006954.1 | Bibersteinia trehalosi USDA-ARS-USMARC-188 |
| 235 | 1875428 | 1875709 | + | NZ_CP007715.1 | Actinobacillus equuli subsp. equuli |
| 236 | 267060 | 267332 | - | NZ_CP046268.1 | Vibrio spartinae |
| 237 | 2885687 | 2885959 | + | NZ_CP016414.1 | Vibrio scophthalmi |
| 238 | 101762 | 102034 | - | NZ_CP009354.1 | Vibrio tubiashii ATCC 19109 |
| 239 | 139277 | 139549 | - | NZ_CP045350.1 | Vibrio aquimaris |
| 240 | 219465 | 219737 | - | NZ_CP047475.1 | Vibrio astriarenae |
| 241 | 1031210 | 1031491 | - | NC_011852.1 | Glaesserella parasuis SH0165 |
| 242 | 2154890 | 2155174 | + | NZ_CP016180.1 | Pasteurella skyensis |
| 243 | 921580 | 921870 | + | NZ_CP007445.1 | Gilliamella apicola |
| 244 | 4160579 | 4160842 | + | NZ_CP019650.1 | Microbulbifer agarilyticus |
| 245 | 933379 | 933660 | - | NZ_CP015425.1 | [Haemophilus] ducreyi |
| 246 | 355898 | 356179 | - | NZ_CP029206.1 | Actinobacillus porcitonsillarum |
| 247 | 1951191 | 1951472 | - | NZ_CP016604.1 | Otariodibacter oris |
| 248 | 948786 | 949052 | + | NZ_CP014143.1 | Microbulbifer aggregans |
| 249 | 1356190 | 1356450 | - | NC_017856.1 | Methylophaga frappieri |
| 250 | 2223669 | 2223953 | - | NZ_AP012273.1 | Thiolapillus brandeum |
| 251 | 3339275 | 3339538 | - | NC_011901.1 | Thioalkalivibrio sulfidiphilus HL-EbGr7 |
| 252 | 642146 | 642436 | + | NZ_CP035704.1 | Pseudolysobacter antarcticus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP019706.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00625.23 | 0.93 | 233 | 55.0 | same-strand | Guanylate kinase |
| 2 | PF13328.8 | 1.0 | 250 | 20 | same-strand | HD domain |
| 3 | PF04607.19 | 0.99 | 249 | 20.0 | same-strand | Region found in RelA / SpoT proteins |
| 4 | PF02824.23 | 1.0 | 250 | 20 | same-strand | TGS domain |
| 5 | PF13291.8 | 0.99 | 249 | 20.0 | same-strand | ACT domain |
| 6 | PF01966.24 | 1.0 | 250 | 20 | same-strand | HD domain |
| 7 | PF00588.21 | 0.76 | 190 | 2166 | same-strand | SpoU rRNA Methylase family |
| 8 | PF12105.10 | 0.75 | 189 | 2166.0 | same-strand | SpoU, rRNA methylase, C-terminal |
| 9 | PF00270.31 | 0.8 | 200 | 2832 | same-strand | DEAD/DEAH box helicase |
| 10 | PF00271.33 | 0.83 | 208 | 2832 | same-strand | Helicase conserved C-terminal domain |
| 11 | PF17191.6 | 0.83 | 208 | 2832 | same-strand | RecG wedge domain |
| 12 | PF04851.17 | 0.83 | 209 | 2832.0 | same-strand | Type III restriction enzyme, res subunit |
| 13 | PF01336.27 | 0.82 | 205 | 2832.0 | same-strand | OB-fold nucleic acid binding domain |
++ More..