Result : EXP00151
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00151 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 461905 |
| Right | 462033 |
| Strand | + |
| Nucleotide Sequence | TTGTTACACCATGATGGACAGCTTACGCACGGCTGCAAACAGTCTCGTGCTCAAGATTATTTTCGGTATCATTATCGTGTCGTTCATATTGACCGGCGTGAGTGGTTACCTGATTGGCGGAGGCAATAA |
| Sequence | LLHHDGQLTHGCKQSRAQDYFRYHYRVVHIDRREWLPDWRRQ |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 27013550 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 42 |
++ More..
| Conservation Analysis |
No. of Species: 21
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1106594 | 1106722 | + | NZ_LR134340.1 | Escherichia marmotae |
| 2 | 527958 | 528086 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 3 | 461905 | 462033 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 4 | 397005 | 397133 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 5 | 3329982 | 3330110 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 6 | 479696 | 479824 | + | NZ_AP014857.1 | Escherichia albertii |
| 7 | 4442541 | 4442684 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 8 | 4695384 | 4695509 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 9 | 4400163 | 4400309 | - | NZ_CP050508.1 | Raoultella terrigena |
| 10 | 2218932 | 2219054 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 11 | 1122823 | 1122927 | + | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 12 | 1113223 | 1113327 | + | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 13 | 2322857 | 2322961 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 14 | 3030096 | 3030200 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 15 | 1114350 | 1114454 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 16 | 381644 | 381766 | - | NZ_CP019706.1 | Pantoea alhagi |
| 17 | 3458465 | 3458593 | - | NC_017554.1 | Pantoea ananatis PA13 |
| 18 | 2386092 | 2386199 | + | NZ_CP040428.1 | Jejubacter calystegiae |
| 19 | 3066256 | 3066381 | - | NZ_CP038853.1 | Pantoea vagans |
| 20 | 987227 | 987349 | + | NZ_CP034148.1 | Pantoea agglomerans |
| 21 | 3924135 | 3924257 | + | NZ_CP049115.1 | Pantoea stewartii |
| 22 | 1067981 | 1068109 | + | NC_013961.1 | Erwinia amylovora CFBP1430 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR134340.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05698.16 | 0.95 | 20 | 5550 | same-strand | Bacterial trigger factor protein (TF) C-terminus |
| 2 | PF05697.15 | 0.95 | 20 | 5550 | same-strand | Bacterial trigger factor protein (TF) |
| 3 | PF00254.30 | 0.95 | 20 | 5550 | same-strand | FKBP-type peptidyl-prolyl cis-trans isomerase |
| 4 | PF00574.25 | 1.0 | 21 | 4627.0 | same-strand | Clp protease |
| 5 | PF07724.16 | 1.0 | 21 | 3228 | same-strand | AAA domain (Cdc48 subfamily) |
| 6 | PF06689.15 | 1.0 | 21 | 3228 | same-strand | ClpX C4-type zinc finger |
| 7 | PF10431.11 | 1.0 | 21 | 3228 | same-strand | C-terminal, D2-small domain, of ClpB protein |
| 8 | PF05362.15 | 1.0 | 21 | 687.5 | same-strand | Lon protease (S16) C-terminal proteolytic domain |
| 9 | PF02190.18 | 1.0 | 21 | 687.5 | same-strand | ATP-dependent protease La (LON) substrate-binding domain |
| 10 | PF00004.31 | 1.0 | 21 | 687.5 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 11 | PF07728.16 | 1.0 | 21 | 687.5 | same-strand | AAA domain (dynein-related subfamily) |
| 12 | PF13541.8 | 1.0 | 21 | 687.5 | same-strand | Subunit ChlI of Mg-chelatase |
| 13 | PF00216.23 | 0.81 | 17 | 206.0 | same-strand | Bacterial DNA-binding protein |
| 14 | PF13624.8 | 1.0 | 21 | -115.0 | same-strand | SurA N-terminal domain |
| 15 | PF13623.8 | 1.0 | 21 | -115.0 | same-strand | SurA N-terminal domain |
| 16 | PF13145.8 | 1.0 | 21 | -115.0 | same-strand | PPIC-type PPIASE domain |
| 17 | PF00639.23 | 1.0 | 21 | -115.0 | same-strand | PPIC-type PPIASE domain |
| 18 | PF12836.9 | 1.0 | 21 | 1904.0 | same-strand | Helix-hairpin-helix motif |
| 19 | PF13279.8 | 1.0 | 21 | 2378.5 | same-strand | Thioesterase-like superfamily |
| 20 | PF03061.24 | 1.0 | 21 | 2378.5 | same-strand | Thioesterase superfamily |
| 21 | PF06508.15 | 0.81 | 17 | 2825.0 | opposite-strand | Queuosine biosynthesis protein QueC |
++ More..