Protein Information |
Information Type | Description |
---|---|
Protein name | EXP00151 |
NCBI Accession ID | NC_000913.3 |
Organism | Escherichia coli str. K-12 substr. MG1655 |
Left | 461905 |
Right | 462033 |
Strand | + |
Nucleotide Sequence | TTGTTACACCATGATGGACAGCTTACGCACGGCTGCAAACAGTCTCGTGCTCAAGATTATTTTCGGTATCATTATCGTGTCGTTCATATTGACCGGCGTGAGTGGTTACCTGATTGGCGGAGGCAATAA |
Sequence | LLHHDGQLTHGCKQSRAQDYFRYHYRVVHIDRREWLPDWRRQ |
Source of smORF | Ribo-seq |
Function | |
Pubmed ID | 30904393 27013550 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 42 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1106594 | 1106722 | + | NZ_LR134340.1 | Escherichia marmotae |
2 | 527958 | 528086 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
3 | 461905 | 462033 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
4 | 397005 | 397133 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
5 | 3329982 | 3330110 | + | NZ_CP061527.1 | Shigella dysenteriae |
6 | 479696 | 479824 | + | NZ_AP014857.1 | Escherichia albertii |
7 | 4442541 | 4442684 | - | NZ_CP045205.1 | Citrobacter telavivensis |
8 | 4695384 | 4695509 | - | NZ_CP060111.1 | Klebsiella michiganensis |
9 | 4400163 | 4400309 | - | NZ_CP050508.1 | Raoultella terrigena |
10 | 2218932 | 2219054 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
11 | 1122823 | 1122927 | + | NZ_CP012264.1 | Cronobacter condimenti 1330 |
12 | 1113223 | 1113327 | + | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
13 | 2322857 | 2322961 | - | NZ_CP027107.1 | Cronobacter sakazakii |
14 | 3030096 | 3030200 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
15 | 1114350 | 1114454 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
16 | 381644 | 381766 | - | NZ_CP019706.1 | Pantoea alhagi |
17 | 3458465 | 3458593 | - | NC_017554.1 | Pantoea ananatis PA13 |
18 | 2386092 | 2386199 | + | NZ_CP040428.1 | Jejubacter calystegiae |
19 | 3066256 | 3066381 | - | NZ_CP038853.1 | Pantoea vagans |
20 | 987227 | 987349 | + | NZ_CP034148.1 | Pantoea agglomerans |
21 | 3924135 | 3924257 | + | NZ_CP049115.1 | Pantoea stewartii |
22 | 1067981 | 1068109 | + | NC_013961.1 | Erwinia amylovora CFBP1430 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF05698.16 | 0.95 | 20 | 5550 | same-strand | Bacterial trigger factor protein (TF) C-terminus |
2 | PF05697.15 | 0.95 | 20 | 5550 | same-strand | Bacterial trigger factor protein (TF) |
3 | PF00254.30 | 0.95 | 20 | 5550 | same-strand | FKBP-type peptidyl-prolyl cis-trans isomerase |
4 | PF00574.25 | 1.0 | 21 | 4627.0 | same-strand | Clp protease |
5 | PF07724.16 | 1.0 | 21 | 3228 | same-strand | AAA domain (Cdc48 subfamily) |
6 | PF06689.15 | 1.0 | 21 | 3228 | same-strand | ClpX C4-type zinc finger |
7 | PF10431.11 | 1.0 | 21 | 3228 | same-strand | C-terminal, D2-small domain, of ClpB protein |
8 | PF05362.15 | 1.0 | 21 | 687.5 | same-strand | Lon protease (S16) C-terminal proteolytic domain |
9 | PF02190.18 | 1.0 | 21 | 687.5 | same-strand | ATP-dependent protease La (LON) substrate-binding domain |
10 | PF00004.31 | 1.0 | 21 | 687.5 | same-strand | ATPase family associated with various cellular activities (AAA) |
11 | PF07728.16 | 1.0 | 21 | 687.5 | same-strand | AAA domain (dynein-related subfamily) |
12 | PF13541.8 | 1.0 | 21 | 687.5 | same-strand | Subunit ChlI of Mg-chelatase |
13 | PF00216.23 | 0.81 | 17 | 206.0 | same-strand | Bacterial DNA-binding protein |
14 | PF13624.8 | 1.0 | 21 | -115.0 | same-strand | SurA N-terminal domain |
15 | PF13623.8 | 1.0 | 21 | -115.0 | same-strand | SurA N-terminal domain |
16 | PF13145.8 | 1.0 | 21 | -115.0 | same-strand | PPIC-type PPIASE domain |
17 | PF00639.23 | 1.0 | 21 | -115.0 | same-strand | PPIC-type PPIASE domain |
18 | PF12836.9 | 1.0 | 21 | 1904.0 | same-strand | Helix-hairpin-helix motif |
19 | PF13279.8 | 1.0 | 21 | 2378.5 | same-strand | Thioesterase-like superfamily |
20 | PF03061.24 | 1.0 | 21 | 2378.5 | same-strand | Thioesterase superfamily |
21 | PF06508.15 | 0.81 | 17 | 2825.0 | opposite-strand | Queuosine biosynthesis protein QueC |