ProsmORF-pred
Result : B0TJ19
Protein Information
Information Type Description
Protein name Sec-independent protein translocase protein TatA
NCBI Accession ID CP000931.1
Organism Shewanella halifaxensis (strain HAW-EB4)
Left 4706150
Right 4706437
Strand +
Nucleotide Sequence ATGGGTGGCATTAGTATTTGGCAACTTCTTATCATTGCTTTAATTGTCGTATTATTGTTTGGAACTAAGAAGTTACGCTCACTAGGCGGCGATTTAGGCGGTGCTGTTAAAGGCTTTAAGAACGCCATGACTTCTGAAGAAGATAAGAAAGCTTTAGAAGATAACGCAGCCGACAAACCAGCTGCAGACGCGGCAAAAGTGACAGAAACAGCAAAAGTTGCAGAAACTGCACCTGTTGCAGAGACAGCCGAAAAAAAGGCTGAGTCTAAAGGCAAAGAACAGGCGTAA
Sequence MGGISIWQLLIIALIVVLLFGTKKLRSLGGDLGGAVKGFKNAMTSEEDKKALEDNAADKPAADAAKVTETAKVAETAPVAETAEKKAESKGKEQA
Source of smORF Swiss-Prot
Function Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}.
Pubmed ID
Domain CDD:294511
Functional Category Others
Uniprot ID B0TJ19
ORF Length (Amino Acid) 95
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 129
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 4706150 4706437 + NC_010334.1 Shewanella halifaxensis HAW-EB4
2 4610258 4610527 + NC_009901.1 Shewanella pealeana ATCC 700345
3 469716 469955 - NC_011566.1 Shewanella piezotolerans WP3
4 463499 463756 - NZ_CP022358.1 Shewanella bicestrii
5 602977 603222 - NZ_CP046378.1 Shewanella algae
6 3774818 3775048 + NZ_CP022272.1 Shewanella marisflavi
7 4025915 4026145 + NC_009092.1 Shewanella loihica PV-4
8 492787 493026 - NC_016901.1 Shewanella baltica OS678
9 739718 739969 - NC_010506.1 Shewanella woodyi ATCC 51908
10 5015224 5015460 + NC_009831.1 Shewanella sediminis HAW-EB3
11 3136145 3136375 - NZ_CP036200.1 Shewanella maritima
12 538716 538961 - NC_008345.1 Shewanella frigidimarina NCIMB 400
13 4317655 4317894 + NC_014012.1 Shewanella violacea DSS12
14 4408571 4408810 + NZ_CP020472.1 Shewanella japonica
15 3490731 3490970 + NZ_CP014782.1 Shewanella psychrophila
16 880560 880799 - NZ_CP034015.1 Shewanella livingstonensis
17 3703913 3704146 + NZ_CP069213.1 Shewanella litorisediminis
18 2665446 2665685 + NZ_CP041783.1 Shewanella donghaensis
19 516733 516984 - NZ_CP041036.1 Shewanella polaris
20 4007938 4008186 + NC_014541.1 Ferrimonas balearica DSM 9799
21 104086 104337 + NZ_AP018689.1 Vibrio aphrogenes
22 527903 528142 - NC_007954.1 Shewanella denitrificans OS217
23 4164495 4164749 + NZ_CP016176.1 Xenorhabdus hominickii
24 3861437 3861703 + NC_010554.1 Proteus mirabilis HI4320
25 2496429 2496668 - NZ_CP034759.1 Litorilituus sediminis
26 93813 94067 + NC_011753.2 Vibrio atlanticus
27 3027400 3027648 - NZ_CP032093.1 Vibrio alfacsensis
28 1974666 1974938 + NZ_CP026364.1 Proteus hauseri
29 4704191 4704439 - NZ_AP022188.1 Aeromonas media
30 3685332 3685589 - NZ_CP072455.1 Xenorhabdus budapestensis
31 85010 85258 + NZ_CP030788.1 Vibrio campbellii
32 3012159 3012407 - NZ_CP018312.1 Vibrio rotiferianus
33 1719203 1719451 - NZ_CP019959.1 Vibrio owensii
34 309169 309417 + NZ_CP009467.1 Vibrio harveyi
35 3090199 3090441 - NZ_CP047475.1 Vibrio astriarenae
36 1373845 1374099 - NZ_CP065150.1 Vibrio kanaloae
37 3234941 3235195 - NZ_CP039700.1 Vibrio cyclitrophicus
38 3226482 3226724 - NZ_CP009354.1 Vibrio tubiashii ATCC 19109
39 378974 379243 + NZ_CP047349.1 Proteus terrae subsp. cibarius
40 3405041 3405301 - NZ_CP034035.1 Brenneria rubrifaciens
41 3442729 3443010 - NZ_CP029185.2 Limnobaculum parvum
42 4389082 4389348 - NZ_CP011118.1 Yersinia enterocolitica
43 2859333 2859581 - NZ_AP014524.1 Vibrio cholerae MS6
44 4263052 4263333 - NZ_CP034752.1 Jinshanibacter zhutongyuii
45 249513 249749 + NZ_CP044069.1 Vibrio vulnificus
46 2517301 2517549 - NZ_CP035688.1 Vibrio metoecus
47 3903640 3903894 - NZ_CP038853.1 Pantoea vagans
48 325860 326123 + NZ_CP012264.1 Cronobacter condimenti 1330
49 3923575 3923820 + NZ_CP040449.1 Aeromonas simiae
50 3063334 3063576 + NZ_CP016414.1 Vibrio scophthalmi
51 5158550 5158810 - NC_005126.1 Photorhabdus laumondii subsp. laumondii TTO1
52 1476493 1476756 + NZ_CP040428.1 Jejubacter calystegiae
53 2388505 2388777 - NZ_CP009781.1 Yersinia aldovae 670-83
54 3159996 3160241 - NZ_CP031781.1 Vibrio parahaemolyticus
55 165202 165477 + NZ_LR134531.1 Pragia fontium
56 1790939 1791202 + NZ_CP065640.1 Serratia rubidaea
57 419759 420025 - NC_008709.1 Psychromonas ingrahamii 37
58 3390693 3390959 - NZ_FO704550.1 Xenorhabdus doucetiae
59 3874501 3874755 - NZ_CP034148.1 Pantoea agglomerans
60 3243310 3243570 + NZ_CP011041.1 Pseudoalteromonas tetraodonis
61 3278599 3278859 + NZ_CP011030.1 Pseudoalteromonas issachenkonii
62 2988320 2988562 - NZ_FO704551.1 Xenorhabdus poinarii G6
63 204787 205050 + NZ_CP063425.1 Kosakonia pseudosacchari
64 3358146 3358409 + NZ_CP016337.1 Kosakonia sacchari
65 1357086 1357328 + NZ_CP031560.1 Dickeya dianthicola
66 4535488 4535745 + NZ_CP014137.1 Brenneria goodwinii
67 3574551 3574805 + NZ_CP011028.1 Pseudoalteromonas espejiana DSM 9414
68 217605 217874 + NZ_LS483470.1 Leminorella richardii
69 4294185 4294445 - NZ_AP023184.1 Buttiauxella agrestis
70 3491054 3491308 + NZ_CP033065.1 Pseudoalteromonas agarivorans
71 3550525 3550779 + NZ_CP023464.1 Pseudoalteromonas atlantica
72 142364 142633 + NC_012779.2 Edwardsiella ictaluri 93-146
73 4120078 4120347 + NZ_CP060401.1 Xenorhabdus nematophila
74 1299653 1299916 + NZ_CP023009.1 Lonsdalea britannica
75 660676 660948 - NC_007963.1 Chromohalobacter salexigens DSM 3043
76 511157 511405 + NC_013892.1 Xenorhabdus bovienii SS-2004
77 2195343 2195609 + NZ_CP011254.1 Serratia fonticola
78 3249570 3249818 + NC_011312.1 Aliivibrio salmonicida LFI1238
79 240966 241229 + NZ_CP034036.1 Brenneria nigrifluens DSM 30175 = ATCC 13028
80 101180 101434 - NZ_CP027523.1 Pseudoalteromonas carrageenovora
81 2262394 2262654 - NZ_CP014136.1 Gibbsiella quercinecans
82 253900 254169 + NZ_CP050150.1 Hafnia alvei
83 4489239 4489490 - NZ_LR134376.1 Aeromonas encheleia
84 1909639 1909908 + NZ_CP006664.1 Edwardsiella anguillarum ET080813
85 5172715 5172978 - NZ_CP014007.2 Kosakonia oryzae
86 286741 287007 + NZ_CP006569.1 Sodalis praecaptivus
87 591139 591408 + NZ_CP045205.1 Citrobacter telavivensis
88 157352 157612 + NZ_CP065534.1 Lonsdalea populi
89 2296222 2296476 - NZ_CP044098.1 Citrobacter portucalensis
90 2794158 2794412 + NZ_CP033744.1 Citrobacter freundii
91 1532227 1532496 - NZ_CP023706.1 Edwardsiella tarda
92 3602380 3602649 - NZ_CP016043.1 Edwardsiella hoshinae
93 3307963 3308217 - NZ_CP038469.1 Citrobacter tructae
94 4525433 4525693 - NC_012962.1 Photorhabdus asymbiotica
95 248592 248855 + NZ_LT906479.1 Serratia ficaria
96 253306 253569 + NZ_LR134494.1 Serratia quinivorans
97 235764 236027 + NC_015567.1 Serratia plymuthica AS9
98 3179711 3179977 + NZ_CP009787.1 Yersinia rohdei
99 624036 624299 - NZ_CP007044.2 Chania multitudinisentens RB-25
100 238450 238713 + NZ_CP048784.1 Serratia liquefaciens
101 4707248 4707511 + NZ_CP016948.1 Serratia surfactantfaciens
102 4123247 4123504 - NZ_CP042220.2 Dickeya poaceiphila
103 4814905 4815168 - NZ_CP071320.1 Serratia ureilytica
104 217921 218184 + NZ_CP038662.1 Serratia nematodiphila
105 2533426 2533686 + NZ_CP011104.1 Photorhabdus thracensis
106 3993296 3993535 + NZ_CP043042.1 Marinobacter fonticola
107 174742 174999 + NC_003910.7 Colwellia psychrerythraea 34H
108 649449 649679 + NZ_CP028926.1 Pasteurella multocida
109 5142621 5142863 - NZ_CP011253.3 Pandoraea oxalativorans
110 5297781 5298023 - NZ_LT906435.1 Pandoraea sputorum
111 4941666 4941911 - NC_023018.2 Pandoraea pnomenusa
112 5061057 5061308 - NZ_LR134475.1 Klebsiella aerogenes
113 199166 199417 + NC_016845.1 Klebsiella pneumoniae subsp. pneumoniae HS11286
114 5012869 5013120 - NZ_CP065838.1 Klebsiella quasipneumoniae
115 5302397 5302648 - NZ_CP054254.1 Klebsiella variicola
116 1516992 1517231 - NZ_CP052766.1 Alteromonas pelagimontana
117 3386114 3386368 + NZ_CP021435.1 Halomonas beimenensis
118 3886260 3886517 - NC_017910.1 Shimwellia blattae DSM 4481 = NBRC 105725
119 320328 320585 - NZ_LR134510.1 Actinobacillus delphinicola
120 403227 403487 + NZ_CP070624.1 Photobacterium damselae subsp. damselae
121 3144159 3144425 + NZ_CP014226.1 Halomonas chromatireducens
122 3088168 3088413 + NZ_LS483250.1 Moritella yayanosii
123 3900187 3900432 - NZ_CP044399.1 Moritella marina ATCC 15381
124 3726465 3726707 - NZ_CP036536.1 Salinimonas lutimaris
125 4484467 4484730 + NZ_CP031123.2 Providencia huaxiensis
126 219071 219334 - NZ_CP029736.1 Providencia rettgeri
127 661928 662191 + NZ_LS483422.1 Providencia heimbachae
128 426326 426595 - NZ_CP023536.1 Providencia alcalifaciens
129 134188 134424 - NZ_CP017689.1 Thalassotalea crassostreae
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_AP018689.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF01209.20 0.92 119 2363 same-strand ubiE/COQ5 methyltransferase family
2 PF13649.8 0.92 119 2363 same-strand Methyltransferase domain
3 PF08241.14 0.92 119 2363 same-strand Methyltransferase domain
4 PF13489.8 0.91 118 2362.5 same-strand Methyltransferase domain
5 PF08242.14 0.92 119 2363 same-strand Methyltransferase domain
6 PF02036.19 0.93 120 1716.0 same-strand SCP-2 sterol transfer family
7 PF03109.18 0.94 121 82 same-strand ABC1 atypical kinase-like domain
8 PF00902.20 0.99 128 513.0 same-strand Sec-independent protein translocase protein (TatC)
9 PF01026.23 0.78 100 1489.0 same-strand TatD related DNase
10 PF02646.18 0.6 78 3195.0 same-strand RmuC family
++ More..