Result : EXP00147
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00147 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 1737834 |
| Right | 1737932 |
| Strand | + |
| Nucleotide Sequence | GTGAAATGGAATGGCAACAATAAAAGATGTAGCGAAACGAGCAAACGTTTCCACTACAACTGTGTCACACGTGATCAACAAAACACGTTTCGTCGCTGA |
| Sequence | VKWNGNNKRCSETSKRFHYNCVTRDQQNTFRR |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 27013550 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 32 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2337682 | 2337780 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 1737834 | 1737932 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 1717523 | 1717621 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 1884803 | 1884901 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 5 | 2075354 | 2075464 | - | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 1966827 | 1966919 | - | NC_012912.1 | Dickeya chrysanthemi Ech1591 |
| 7 | 2871746 | 2871838 | + | NC_014500.1 | Dickeya dadantii 3937 |
| 8 | 125208 | 125300 | + | NZ_CP015137.1 | Dickeya solani IPO 2222 |
| 9 | 1765184 | 1765276 | - | NZ_CP042220.2 | Dickeya poaceiphila |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00462.26 | 1.0 | 8 | 3718 | opposite-strand | Glutaredoxin |
| 2 | PF00877.21 | 1.0 | 8 | 2568 | same-strand | NlpC/P60 family |
| 3 | PF13377.8 | 0.88 | 7 | -79.0 | same-strand | Periplasmic binding protein-like domain |
| 4 | PF00532.23 | 1.0 | 8 | -88 | same-strand | Periplasmic binding proteins and sugar binding domain of LacI family |
| 5 | PF13407.8 | 1.0 | 8 | -88 | same-strand | Periplasmic binding protein domain |
| 6 | PF00356.23 | 1.0 | 8 | -88 | same-strand | Bacterial regulatory proteins, lacI family |
| 7 | PF02353.22 | 1.0 | 8 | 3469 | same-strand | Mycolic acid cyclopropane synthetase |
| 8 | PF13649.8 | 1.0 | 8 | 3469 | same-strand | Methyltransferase domain |
| 9 | PF08241.14 | 1.0 | 8 | 3469 | same-strand | Methyltransferase domain |
| 10 | PF08242.14 | 1.0 | 8 | 3469 | same-strand | Methyltransferase domain |
| 11 | PF00677.19 | 1.0 | 8 | 4669 | opposite-strand | Lumazine binding domain |
++ More..