Result : EXP00140

Protein Information

• Protein name: EXP00140
• NCBI Accession ID: NC_000913.3
• Organism: Escherichia coli str. K-12 substr. MG1655
• Left: 3931193
• Right: 3931312
• Strand: +
• Nucleotide Sequence: TTGAGCCAGGTTAATGTGGCCGCATTTAGGAGTACGATTTTGCCGTTAATCGTGCATACTGTGCGCTTTTTTGTGGGCCAAGGGACTAAGCACACATTTCATATTTCAACGAAAGACTAG
• Sequence: LSQVNVAAFRSTILPLIVHTVRFFVGQGTKHTFHISTKD
• Source of smORF: Ribo-seq
• Pubmed ID: 30904393 27013550
• Functional Category: Function not yet assigned
• ORF Length (Amino Acid): 39

Conservation Analysis

No. of Species: 13

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	4724762	4724881	+	NC_002695.2	Escherichia coli O157:H7 str. Sakai
2	3931193	3931312	+	NC_000913.3	Escherichia coli str. K-12 substr. MG1655
3	3939897	3940016	+	NC_004337.2	Shigella flexneri 2a str. 301
4	4257972	4258091	+	NZ_CP061527.1	Shigella dysenteriae
5	4411798	4411917	-	NZ_LR134340.1	Escherichia marmotae
6	3898080	3898199	+	NZ_AP014857.1	Escherichia albertii
7	4227621	4227731	-	NC_013716.1	Citrobacter rodentium ICC168
8	5223	5342	+	NZ_CP063425.1	Kosakonia pseudosacchari
9	4646103	4646222	-	NZ_CP035129.1	Kosakonia cowanii
10	2841560	2841685	-	NZ_CP057657.1	Escherichia fergusonii
11	1179651	1179782	-	NZ_LT556085.1	Citrobacter amalonaticus
12	4569841	4569960	-	NZ_CP011602.1	Phytobacter ursingii
13	440431	440550	-	NZ_CP051548.1	Phytobacter diazotrophicus
14	4102376	4102477	-	NC_017910.1	Shimwellia blattae DSM 4481 = NBRC 105725

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_002695.2

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF00258.27	0.77	10	4739	opposite-strand	Flavodoxin
2	PF01037.23	0.92	12	4190	opposite-strand	Lrp/AsnC ligand binding domain
3	PF13412.8	0.92	12	4190	opposite-strand	Winged helix-turn-helix DNA-binding
4	PF13404.8	0.92	12	4190	opposite-strand	AsnC-type helix-turn-helix domain
5	PF03590.17	0.92	12	3046	same-strand	Aspartate-ammonia ligase
6	PF13519.8	1.0	13	1590.0	opposite-strand	von Willebrand factor type A domain
7	PF20030.1	1.0	13	100.0	opposite-strand	MoxR domain in the MoxR-vWA-beta-propeller ternary systems
8	PF07728.16	1.0	13	100.0	opposite-strand	AAA domain (dynein-related subfamily)
9	PF12592.10	1.0	13	100.0	opposite-strand	Protein of unknown function (DUF3763)
10	PF17868.3	1.0	13	100.0	opposite-strand	AAA lid domain
11	PF07726.13	0.69	9	100.0	opposite-strand	ATPase family associated with various cellular activities (AAA)
12	PF02705.18	1.0	13	4.0	same-strand	K+ potassium transporter
13	PF05025.15	0.92	12	2055	same-strand	RbsD / FucU transport protein family
14	PF00005.29	1.0	13	2485.5	same-strand	ABC transporter
15	PF02653.18	0.85	11	3995.5	same-strand	Branched-chain amino acid transport system / permease component
16	PF13407.8	0.85	11	4987.5	same-strand	Periplasmic binding protein domain
17	PF00532.23	0.85	11	4987.5	same-strand	Periplasmic binding proteins and sugar binding domain of LacI family
18	PF13377.8	0.85	11	4987.5	same-strand	Periplasmic binding protein-like domain