ProsmORF-pred
Result : B0TGP1
Protein Information
Information Type Description
Protein name UPF0235 protein Helmi_20270
NCBI Accession ID CP000930.2
Organism Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Left 2096323
Right 2096613
Strand +
Nucleotide Sequence ATGGGTTGGATTCAGGAACAGCCCGGCGGCTCGATTCGTTTCAGGATCCGGGTGCAGCCGCGGGCATCGAAAAACGAGGTCTGCGGTCTTTTAGACGATGCCTTGAAGGTCCGCCTGACGGCGCCGCCTGTCGACGGTGAGGCGAACGCCGCTTGCCTGCAGTTTATTGCCAAGACCCTCGGCCTCTCCCGCAGCCAGGTGCGTCTGGTGGCGGGGGAGACGTCGCGCTTGAAGACACTTGAGGTGGAGGGAGTCAGTGCAGAGGATTTGCGCAAGAGGTTTGACATCTGA
Sequence MGWIQEQPGGSIRFRIRVQPRASKNEVCGLLDDALKVRLTAPPVDGEANAACLQFIAKTLGLSRSQVRLVAGETSRLKTLEVEGVSAEDLRKRFDI
Source of smORF Swiss-Prot
Function The ORF matches to the profile of cl00811. Profile Description: Uncharacterized ACR, YggU family COG1872. hypothetical protein; Validated
Pubmed ID 18441057
Domain CDD:412584
Functional Category Others
Uniprot ID B0TGP1
ORF Length (Amino Acid) 96
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 17
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 2096323 2096613 + NC_010337.2 Heliomicrobium modesticaldum Ice1
2 330070 330348 + NZ_CP045798.1 Thermoanaerosceptrum fracticalcis
3 1112342 1112590 + NC_013216.1 Desulfofarcimen acetoxidans DSM 771
4 3624718 3624957 - NC_021184.1 Desulfoscipio gibsoniae DSM 7213
5 2646716 2647024 + NZ_CP009788.1 Geobacter pickeringii
6 2168951 2169253 - NZ_CP036259.1 Sporomusa termitida
7 6222483 6222734 + NC_017030.1 Corallococcus coralloides DSM 2259
8 856284 856526 + NC_014220.1 Syntrophothermus lipocalidus DSM 12680
9 1378761 1379069 + NC_009483.1 Geobacter uraniireducens Rf4
10 1988639 1988893 + NC_011979.1 Geobacter daltonii FRC-32
11 4511677 4511937 - NC_020126.1 Myxococcus stipitatus DSM 14675
12 1289079 1289321 - NC_007517.1 Geobacter metallireducens GS-15
13 246310 246645 - NZ_AP018786.1 Sutterella megalosphaeroides
14 4591624 4591872 - NC_008576.1 Magnetococcus marinus MC-1
15 8502802 8503038 - NZ_CP011125.1 Sandaracinus amylolyticus
16 4415068 4415331 - NC_005027.1 Rhodopirellula baltica SH 1
17 951845 952096 - NZ_CP012332.1 Vulgatibacter incomptus
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_010337.2
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF05103.15 0.65 11 40 same-strand DivIVA protein
++ More..