Protein Information |
Information Type | Description |
---|---|
Protein name | UPF0473 protein Helmi_02360 |
NCBI Accession ID | CP000930.2 |
Organism | Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) |
Left | 252150 |
Right | 252419 |
Strand | - |
Nucleotide Sequence | GTGGATCAGGAACAAGAAAACATCATCGTCCTGACTGATGAAGACGGTAACGAACTGGAGTTTGAGGAACTGGACCGCGTCGAAGTCGATGGCAAGGAGTACGCCATCCTCCTGCCTCTCGACGATGAAGAGGATGAAGCCATCATCCTCCGCGTTGAGTATGAGGAAAACGGCGAAGAAGTGTTCAGCCATATCGAAGACGACGAAGAATGGGAGAAGGTCGCCGACTTCTGGCAGGAACTGAGCGAAGAAGACGGCGAAGAAGAGTAA |
Sequence | MDQEQENIIVLTDEDGNELEFEELDRVEVDGKEYAILLPLDDEEDEAIILRVEYEENGEEVFSHIEDDEEWEKVADFWQELSEEDGEEE |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl01608. Profile Description: Protein of unknown function (DUF1292). hypothetical protein; Provisional |
Pubmed ID | 18441057 |
Domain | CDD:412983 |
Functional Category | Others |
Uniprot ID | B0TFZ1 |
ORF Length (Amino Acid) | 89 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 252150 | 252419 | - | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
2 | 548103 | 548369 | + | NZ_CP045875.1 | Heliorestis convoluta |
3 | 851545 | 851784 | + | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
4 | 829913 | 830176 | + | NC_009253.1 | Desulfotomaculum reducens MI-1 |
5 | 2774223 | 2774501 | - | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
6 | 3216732 | 3217001 | - | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
7 | 1697142 | 1697369 | - | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
8 | 2434964 | 2435191 | - | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
9 | 2107855 | 2108097 | - | NZ_CP024955.1 | Kyrpidia spormannii |
10 | 2618033 | 2618284 | - | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
11 | 1119706 | 1119948 | + | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
12 | 1442660 | 1442908 | - | NC_013385.1 | Ammonifex degensii KC4 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03652.17 | 0.92 | 11 | 106 | same-strand | Holliday junction resolvase |
2 | PF06135.14 | 1.0 | 12 | 1490.5 | same-strand | IreB regulatory phosphoprotein |
3 | PF02272.21 | 0.67 | 8 | 1939.5 | same-strand | DHHA1 domain |
4 | PF07973.16 | 0.67 | 8 | 1939.5 | same-strand | Threonyl and Alanyl tRNA synthetase second additional domain |