Result : EXP00128
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00128 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli str. K-12 substr. MG1655 |
| Left | 2969591 |
| Right | 2969716 |
| Strand | + |
| Nucleotide Sequence | ATGTGGAAAAAGTTACACTGCGAATATTCGGCACATAATTGCTGTTTGTTTTTTAATCAAGGTATCATGACATGTCCCAACCTCGCCCACTGCTCTCTCCTCCCGAAACTGAAGAACAGTTGTTAG |
| Sequence | MWKKLHCEYSAHNCCLFFNQGIMTCPNLAHCSLLPKLKNSC |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 27013550 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 41 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2969591 | 2969716 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 781769 | 781894 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 3 | 3692118 | 3692243 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 2929952 | 2930077 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00303.21 | 1.0 | 3 | 4436.0 | opposite-strand | Thymidylate synthase |
| 2 | PF01790.20 | 1.0 | 3 | 3554.0 | opposite-strand | Prolipoprotein diacylglyceryl transferase |
| 3 | PF02896.20 | 1.0 | 3 | 1157.0 | opposite-strand | PEP-utilising enzyme, PEP-binding domain |
| 4 | PF05524.15 | 1.0 | 3 | 1157.0 | opposite-strand | PEP-utilising enzyme, N-terminal |
| 5 | PF00391.25 | 1.0 | 3 | 1157.0 | opposite-strand | PEP-utilising enzyme, mobile domain |
| 6 | PF01590.28 | 1.0 | 3 | 1157.0 | opposite-strand | GAF domain |
| 7 | PF13185.8 | 1.0 | 3 | 1157.0 | opposite-strand | GAF domain |
| 8 | PF13492.8 | 1.0 | 3 | 1157.0 | opposite-strand | GAF domain |
| 9 | PF00293.30 | 1.0 | 3 | 614.0 | opposite-strand | NUDIX domain |
| 10 | PF02976.17 | 1.0 | 3 | -54.0 | same-strand | DNA mismatch repair enzyme MutH |
| 11 | PF03741.18 | 1.0 | 3 | 704.0 | same-strand | Integral membrane protein TerC family |
| 12 | PF06004.14 | 1.0 | 3 | 1555.0 | same-strand | Bacterial protein of unknown function (DUF903) |
| 13 | PF00248.23 | 1.0 | 3 | 1881.0 | same-strand | Aldo/keto reductase family |
| 14 | PF07690.18 | 1.0 | 3 | 2953.0 | opposite-strand | Major Facilitator Superfamily |
++ More..