Protein Information |
Information Type | Description |
---|---|
Protein name | EXP00128 |
NCBI Accession ID | NC_000913.3 |
Organism | Escherichia coli str. K-12 substr. MG1655 |
Left | 2969591 |
Right | 2969716 |
Strand | + |
Nucleotide Sequence | ATGTGGAAAAAGTTACACTGCGAATATTCGGCACATAATTGCTGTTTGTTTTTTAATCAAGGTATCATGACATGTCCCAACCTCGCCCACTGCTCTCTCCTCCCGAAACTGAAGAACAGTTGTTAG |
Sequence | MWKKLHCEYSAHNCCLFFNQGIMTCPNLAHCSLLPKLKNSC |
Source of smORF | Ribo-seq |
Function | |
Pubmed ID | 30904393 27013550 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 41 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2969591 | 2969716 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
2 | 781769 | 781894 | - | NZ_CP061527.1 | Shigella dysenteriae |
3 | 3692118 | 3692243 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
4 | 2929952 | 2930077 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00303.21 | 1.0 | 3 | 4436.0 | opposite-strand | Thymidylate synthase |
2 | PF01790.20 | 1.0 | 3 | 3554.0 | opposite-strand | Prolipoprotein diacylglyceryl transferase |
3 | PF02896.20 | 1.0 | 3 | 1157.0 | opposite-strand | PEP-utilising enzyme, PEP-binding domain |
4 | PF05524.15 | 1.0 | 3 | 1157.0 | opposite-strand | PEP-utilising enzyme, N-terminal |
5 | PF00391.25 | 1.0 | 3 | 1157.0 | opposite-strand | PEP-utilising enzyme, mobile domain |
6 | PF01590.28 | 1.0 | 3 | 1157.0 | opposite-strand | GAF domain |
7 | PF13185.8 | 1.0 | 3 | 1157.0 | opposite-strand | GAF domain |
8 | PF13492.8 | 1.0 | 3 | 1157.0 | opposite-strand | GAF domain |
9 | PF00293.30 | 1.0 | 3 | 614.0 | opposite-strand | NUDIX domain |
10 | PF02976.17 | 1.0 | 3 | -54.0 | same-strand | DNA mismatch repair enzyme MutH |
11 | PF03741.18 | 1.0 | 3 | 704.0 | same-strand | Integral membrane protein TerC family |
12 | PF06004.14 | 1.0 | 3 | 1555.0 | same-strand | Bacterial protein of unknown function (DUF903) |
13 | PF00248.23 | 1.0 | 3 | 1881.0 | same-strand | Aldo/keto reductase family |
14 | PF07690.18 | 1.0 | 3 | 2953.0 | opposite-strand | Major Facilitator Superfamily |