Result : B0TEJ2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
| NCBI Accession ID | CP000930.2 |
| Organism | Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) |
| Left | 492415 |
| Right | 492666 |
| Strand | - |
| Nucleotide Sequence | GTGGCAAAGGGAAAAGCAAACCTGAATCTGACTTACGAAGCGGCCATCGGTCGCCTCGAAGAGGTGGTGCGGTCGCTGGAGACGGGCGAAGCCTCTTTGGATGAATCGTTAAAGCTCTTTCAGGAGGGCATCGGCCTGGTCCGTCACTGCCATTCCCAATTGGACGCCTACGAGGCCAAGGTGCAACGGCTGATCGAGACCCCCGACGGCGCGGCTGTCGTCGAAGAGCGACGAACTGAGGAGGGGGAATAG |
| Sequence | MAKGKANLNLTYEAAIGRLEEVVRSLETGEASLDESLKLFQEGIGLVRHCHSQLDAYEAKVQRLIETPDGAAVVEERRTEEGE |
| Source of smORF | Swiss-Prot |
| Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
| Pubmed ID | 18441057 |
| Domain | CDD:412547 |
| Functional Category | Others |
| Uniprot ID | B0TEJ2 |
| ORF Length (Amino Acid) | 83 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 492415 | 492666 | - | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 2 | 762275 | 762505 | + | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_010337.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01728.21 | 1.0 | 2 | 4291.0 | same-strand | FtsJ-like methyltransferase |
| 2 | PF01479.27 | 1.0 | 2 | 4291.0 | same-strand | S4 domain |
| 3 | PF13292.8 | 1.0 | 2 | 2304.0 | same-strand | 1-deoxy-D-xylulose-5-phosphate synthase |
| 4 | PF02779.26 | 1.0 | 2 | 2304.0 | same-strand | Transketolase, pyrimidine binding domain |
| 5 | PF02780.22 | 1.0 | 2 | 2304.0 | same-strand | Transketolase, C-terminal domain |
| 6 | PF00348.19 | 1.0 | 2 | 3.0 | same-strand | Polyprenyl synthetase |
| 7 | PF13742.8 | 1.0 | 2 | -15.5 | same-strand | OB-fold nucleic acid binding domain |
| 8 | PF01336.27 | 1.0 | 2 | -15.5 | same-strand | OB-fold nucleic acid binding domain |
| 9 | PF14691.8 | 1.0 | 2 | 1832.5 | same-strand | Dihydroprymidine dehydrogenase domain II, 4Fe-4S cluster |
| 10 | PF07992.16 | 1.0 | 2 | 1832.5 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 11 | PF00070.29 | 1.0 | 2 | 1832.5 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 12 | PF10418.11 | 1.0 | 2 | 3225.0 | same-strand | Iron-sulfur cluster binding domain of dihydroorotate dehydrogenase B |
| 13 | PF00175.23 | 1.0 | 2 | 3225.0 | same-strand | Oxidoreductase NAD-binding domain |
| 14 | PF00814.27 | 1.0 | 2 | 4197.0 | same-strand | tRNA N6-adenosine threonylcarbamoyltransferase |
++ More..