| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec-independent protein translocase protein TatA |
| NCBI Accession ID | CP000927.1 |
| Organism | Caulobacter sp. (strain K31) |
| Left | 3384451 |
| Right | 3384675 |
| Strand | - |
| Nucleotide Sequence | ATGGGTGGTATGAGCTGGATTCACTGGGTGATCGTGATCGCGGTCGTCGCCTTGCTGTTTGGCGGGCGTGGAAAGCTGTCCGGCATCATGGGTGATGCGGCCAAGGGCATCAAAGCCTTCAAGGACGGCCTGAAGGACGATTCGTCCGACGAGGTCTCCGCCAACAAGGCCACGGGCGCGCTGCCGCGCACCGAGGCCGAGAAGGAAGACCTGCGCAAGTCGTAG |
| Sequence | MGGMSWIHWVIVIAVVALLFGGRGKLSGIMGDAAKGIKAFKDGLKDDSSDEVSANKATGALPRTEAEKEDLRKS |
| Source of smORF | Swiss-Prot |
| Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
| Pubmed ID | |
| Domain | CDD:294511 |
| Functional Category | Others |
| Uniprot ID | B0T1Q7 |
| ORF Length (Amino Acid) | 74 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3298597 | 3298821 | - | NZ_CP048815.1 | Caulobacter rhizosphaerae |
| 2 | 5115825 | 5116049 | - | NZ_CP026100.1 | Caulobacter flavus |
| 3 | 2232512 | 2232736 | - | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 4 | 2413543 | 2413758 | - | NZ_CP013002.1 | Caulobacter henricii |
| 5 | 1532477 | 1532701 | + | NZ_CP027850.1 | Caulobacter segnis |
| 6 | 1759079 | 1759291 | + | NZ_CP024201.1 | Caulobacter mirabilis |
| 7 | 3314688 | 3314906 | + | NZ_CP022048.2 | Brevundimonas vesicularis |
| 8 | 2563588 | 2563806 | - | NC_014375.1 | Brevundimonas subvibrioides ATCC 15264 |
| 9 | 1634484 | 1634699 | - | NZ_LR588407.1 | Brevundimonas vancanneytii |
| 10 | 1451866 | 1452072 | - | NC_014816.1 | Asticcacaulis excentricus CB 48 |
| 11 | 3193433 | 3193663 | - | NZ_CP025086.1 | Methylovirgula ligni |
| 12 | 1631110 | 1631319 | - | NZ_CP029479.1 | Phenylobacterium parvum |
| 13 | 1301226 | 1301447 | + | NZ_CP018911.1 | Glycocaulis alkaliphilus |
| 14 | 3774086 | 3774301 | - | NZ_CP044331.1 | Methylocystis parvus |
| 15 | 2196800 | 2197012 | - | NC_011144.1 | Phenylobacterium zucineum HLK1 |
| 16 | 1967791 | 1968009 | - | NC_014217.1 | Starkeya novella DSM 506 |
| 17 | 4167729 | 4167956 | + | NZ_CP048630.1 | Ancylobacter pratisalsi |
| 18 | 682511 | 682768 | - | NZ_CP032485.1 | Neokomagataea tanensis |
| 19 | 862299 | 862553 | + | NZ_CP054621.1 | Azospirillum oryzae |
| 20 | 1587958 | 1588203 | - | NZ_CP036404.1 | Komagataeibacter saccharivorans |
| 21 | 1987530 | 1987757 | + | NC_009937.1 | Azorhizobium caulinodans ORS 571 |
| 22 | 95577 | 95816 | + | NZ_CP029830.1 | Azospirillum ramasamyi |
| 23 | 213857 | 214081 | - | NC_017059.1 | Pararhodospirillum photometricum DSM 122 |
| 24 | 801589 | 801834 | + | NZ_CP012403.1 | Azospirillum thiophilum |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00587.27 | 0.62 | 15 | 1777 | same-strand | tRNA synthetase class II core domain (G, H, P, S and T) |
| 2 | PF02403.24 | 0.62 | 15 | 1777 | same-strand | Seryl-tRNA synthetase N-terminal domain |
| 3 | PF00902.20 | 0.92 | 22 | 628.5 | same-strand | Sec-independent protein translocase protein (TatC) |
| 4 | PF04079.18 | 0.71 | 17 | 218 | same-strand | Segregation and condensation complex subunit ScpB |
| 5 | PF00933.23 | 0.67 | 16 | 2023.5 | same-strand | Glycosyl hydrolase family 3 N terminal domain |
| 6 | PF05036.15 | 0.62 | 15 | 3003 | same-strand | SPOR domain |