Result : B0T1Q7

Protein Information

• Protein name: Sec-independent protein translocase protein TatA
• NCBI Accession ID: CP000927.1
• Organism: Caulobacter sp. (strain K31)
• Left: 3384451
• Right: 3384675
• Strand: -
• Nucleotide Sequence: ATGGGTGGTATGAGCTGGATTCACTGGGTGATCGTGATCGCGGTCGTCGCCTTGCTGTTTGGCGGGCGTGGAAAGCTGTCCGGCATCATGGGTGATGCGGCCAAGGGCATCAAAGCCTTCAAGGACGGCCTGAAGGACGATTCGTCCGACGAGGTCTCCGCCAACAAGGCCACGGGCGCGCTGCCGCGCACCGAGGCCGAGAAGGAAGACCTGCGCAAGTCGTAG
• Sequence: MGGMSWIHWVIVIAVVALLFGGRGKLSGIMGDAAKGIKAFKDGLKDDSSDEVSANKATGALPRTEAEKEDLRKS
• Source of smORF: Swiss-Prot
• Function: Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}.
• Domain: CDD:294511
• Functional Category: Others
• Uniprot ID: B0T1Q7
• ORF Length (Amino Acid): 74

Conservation Analysis

No. of Species: 24

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	3298597	3298821	-	NZ_CP048815.1	Caulobacter rhizosphaerae
2	5115825	5116049	-	NZ_CP026100.1	Caulobacter flavus
3	2232512	2232736	-	NC_011916.1	Caulobacter vibrioides NA1000
4	2413543	2413758	-	NZ_CP013002.1	Caulobacter henricii
5	1532477	1532701	+	NZ_CP027850.1	Caulobacter segnis
6	1759079	1759291	+	NZ_CP024201.1	Caulobacter mirabilis
7	3314688	3314906	+	NZ_CP022048.2	Brevundimonas vesicularis
8	2563588	2563806	-	NC_014375.1	Brevundimonas subvibrioides ATCC 15264
9	1634484	1634699	-	NZ_LR588407.1	Brevundimonas vancanneytii
10	1451866	1452072	-	NC_014816.1	Asticcacaulis excentricus CB 48
11	3193433	3193663	-	NZ_CP025086.1	Methylovirgula ligni
12	1631110	1631319	-	NZ_CP029479.1	Phenylobacterium parvum
13	1301226	1301447	+	NZ_CP018911.1	Glycocaulis alkaliphilus
14	3774086	3774301	-	NZ_CP044331.1	Methylocystis parvus
15	2196800	2197012	-	NC_011144.1	Phenylobacterium zucineum HLK1
16	1967791	1968009	-	NC_014217.1	Starkeya novella DSM 506
17	4167729	4167956	+	NZ_CP048630.1	Ancylobacter pratisalsi
18	682511	682768	-	NZ_CP032485.1	Neokomagataea tanensis
19	862299	862553	+	NZ_CP054621.1	Azospirillum oryzae
20	1587958	1588203	-	NZ_CP036404.1	Komagataeibacter saccharivorans
21	1987530	1987757	+	NC_009937.1	Azorhizobium caulinodans ORS 571
22	95577	95816	+	NZ_CP029830.1	Azospirillum ramasamyi
23	213857	214081	-	NC_017059.1	Pararhodospirillum photometricum DSM 122
24	801589	801834	+	NZ_CP012403.1	Azospirillum thiophilum

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_CP048815.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF00587.27	0.62	15	1777	same-strand	tRNA synthetase class II core domain (G, H, P, S and T)
2	PF02403.24	0.62	15	1777	same-strand	Seryl-tRNA synthetase N-terminal domain
3	PF00902.20	0.92	22	628.5	same-strand	Sec-independent protein translocase protein (TatC)
4	PF04079.18	0.71	17	218	same-strand	Segregation and condensation complex subunit ScpB
5	PF00933.23	0.67	16	2023.5	same-strand	Glycosyl hydrolase family 3 N terminal domain
6	PF05036.15	0.62	15	3003	same-strand	SPOR domain