Result : EXP00085
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00085 |
| NCBI Accession ID | CP000480.1 |
| Organism | Mycolicibacterium smegmatis MC2 155 |
| Left | 5284644 |
| Right | 5284781 |
| Strand | - |
| Nucleotide Sequence | ATGTCGGCGGTCAACCGATCTACACGCGAAGGGGCGTTTGAGCATGGCAGGACCACTGCAAGGTTTGCGGGTTGTCGAGTTGGCCGGTATCGGCCCCGGCCCGCACGCGGCGATGATTCTGGGCGATCTGGGCGCTGA |
| Sequence | MSAVNRSTREGAFEHGRTTARFAGCRVGRYRPRPARGDDSGRSGR |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 26536359 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 45 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2916635 | 2916745 | - | NZ_AP022605.1 | Mycobacterium doricum |
| 2 | 4045979 | 4046092 | - | NZ_AP022618.1 | Mycolicibacterium insubricum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP022605.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02515.19 | 1.0 | 2 | -82.0 | same-strand | CoA-transferase family III |
| 2 | PF00378.22 | 1.0 | 2 | 85 | opposite-strand | Enoyl-CoA hydratase/isomerase |
| 3 | PF00132.26 | 1.0 | 2 | 1958.5 | same-strand | Bacterial transferase hexapeptide (six repeats) |
| 4 | PF02469.24 | 1.0 | 2 | 2747.0 | opposite-strand | Fasciclin domain |
++ More..