Protein Information |
Information Type | Description |
---|---|
Protein name | EXP00057 |
NCBI Accession ID | CP000480.1 |
Organism | Mycolicibacterium smegmatis MC2 155 |
Left | 1928397 |
Right | 1928531 |
Strand | - |
Nucleotide Sequence | ATGGGTCAGGGAGGCGTATCCGGTCTGGTGACCGGCGCGGTCTTCAAAATCGCTGAGCGACAGTTTCTGCCGCTGGCGGGTTCGATTCCCGTCCGCCTCCGCCATCGAATGCCAGGACCGCTCCTCCATGACTGA |
Sequence | MGQGGVSGLVTGAVFKIAERQFLPLAGSIPVRLRHRMPGPLLHD |
Source of smORF | Ribo-seq |
Function | |
Pubmed ID | 26536359 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 44 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2000705 | 2000839 | - | NZ_LN831039.1 | Mycolicibacterium smegmatis |
2 | 6350677 | 6350808 | + | NZ_CP012150.1 | Mycobacterium goodii |
3 | 5009652 | 5009777 | - | NZ_AP022590.1 | Mycobacterium mantenii |
4 | 1094354 | 1094479 | + | NZ_CP058277.1 | Mycobacterium marinum |
5 | 308239 | 308364 | - | NZ_AP018410.1 | Mycobacterium pseudoshottsii JCM 15466 |
6 | 1015676 | 1015801 | - | NZ_AP022572.1 | Mycobacterium shottsii |
7 | 2894069 | 2894197 | + | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
8 | 5688550 | 5688660 | - | NC_022116.1 | Amycolatopsis mediterranei RB |
9 | 3853669 | 3853794 | + | NZ_AP022582.1 | Mycobacterium seoulense |
10 | 3691695 | 3691820 | + | NZ_AP022619.1 | Mycobacterium paraseoulense |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01568.23 | 0.6 | 6 | 2712.5 | both-strands | Molydopterin dinucleotide binding domain |
2 | PF04879.18 | 0.8 | 8 | 3055.0 | same-strand | Molybdopterin oxidoreductase Fe4S4 domain |
3 | PF09107.13 | 0.7 | 7 | 1270 | same-strand | Elongation factor SelB, winged helix |
4 | PF03144.27 | 0.7 | 7 | 1270 | same-strand | Elongation factor Tu domain 2 |
5 | PF03841.15 | 1.0 | 10 | -5.0 | same-strand | L-seryl-tRNA selenium transferase |
6 | PF12390.10 | 0.9 | 9 | -7 | same-strand | Selenocysteine synthase N terminal |
7 | PF00586.26 | 1.0 | 10 | 21.0 | opposite-strand | AIR synthase related protein, N-terminal domain |