Result : EXP00052
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00052 |
| NCBI Accession ID | CP000480.1 |
| Organism | Mycolicibacterium smegmatis MC2 155 |
| Left | 1619410 |
| Right | 1619598 |
| Strand | - |
| Nucleotide Sequence | ATGACATGCCTTGAGGGGGTGTACCGATGGCCACTGCGACCAGTCCTACCCACGTCGATTCGACCACATCCGGGAACCAGTTCCGGCTCGGCCTGCTGTTCGCGGTCGGCTCGGCGCTCGCGTTCGGCTCGTCGGGACCGTTCGCCAAGGCTCTCATCGAGGCCGGCTGGAGCCCCACGGCCGCGGTGA |
| Sequence | MTCLEGVYRWPLRPVLPTSIRPHPGTSSGSACCSRSARRSRSARRDRSPRLSSRPAGAPRPR |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 26536359 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 62 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1694174 | 1694362 | - | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 2 | 6688438 | 6688608 | + | NZ_CP012150.1 | Mycobacterium goodii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LN831039.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01416.22 | 1.0 | 2 | 3057.5 | opposite-strand | tRNA pseudouridine synthase |
| 2 | PF01083.24 | 1.0 | 2 | 1692.5 | same-strand | Cutinase |
| 3 | PF00892.22 | 1.0 | 2 | -162.0 | same-strand | EamA-like transporter family |
| 4 | PF11706.10 | 1.0 | 2 | 42.5 | opposite-strand | CGNR zinc finger |
| 5 | PF07336.13 | 1.0 | 2 | 42.5 | opposite-strand | Putative stress-induced transcription regulator |
| 6 | PF05108.15 | 1.0 | 2 | 928.5 | opposite-strand | Type VII secretion system ESX-1, transport TM domain B |
| 7 | PF00082.24 | 1.0 | 2 | 2239.5 | same-strand | Subtilase family |
| 8 | PF08817.12 | 1.0 | 2 | 3554.0 | same-strand | WXG100 protein secretion system (Wss), protein YukD |
++ More..