Result : B0SMB9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Phosphoribosyl-ATP pyrophosphatase (PRA-PH) (EC 3.6.1.31) |
| NCBI Accession ID | CP000786.1 |
| Organism | Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) |
| Left | 971855 |
| Right | 972133 |
| Strand | + |
| Nucleotide Sequence | ATGGAATTTTTATTAAAATTAGAAGATTTACTCCGCAAACGAAAAGAGGAATTACCCGAAAAATCCTACACAGCGGAATTATTCCGAGATGGGGTAGACCGAATCCTAAAAAAAATTGGGGAAGAAGCGGGGGAAGTGATCATCGCCGCAAAAAATCCAAATGAAAAAGAACTCATCCATGAAATTGCAGATTTGATTTTCCATTTAGAAGTGTTAATGGTCGAAAAAGGAATTAGTTTAACTACCATCGCAAAAGAATTAGAAAAAAGACATAGTTAA |
| Sequence | MEFLLKLEDLLRKRKEELPEKSYTAELFRDGVDRILKKIGEEAGEVIIAAKNPNEKELIHEIADLIFHLEVLMVEKGISLTTIAKELEKRHS |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl16941. Profile Description: Nucleoside Triphosphate Pyrophosphohydrolase (EC 3.6.1.8) MazG-like domain superfamily. This family of short proteins are distantly related to the MazG enzyme. This suggests that these proteins are enzymes that catalyze a related reaction. |
| Pubmed ID | 18270594 |
| Domain | CDD:418386 |
| Functional Category | Others |
| Uniprot ID | B0SMB9 |
| ORF Length (Amino Acid) | 92 |
++ More..
| Conservation Analysis |
No. of Species: 201
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 13999 | 14277 | + | NZ_CP020413.2 | Leptospira interrogans serovar Copenhageni |
| 2 | 3263602 | 3263880 | + | NZ_CP033614.1 | Leptospira kmetyi |
| 3 | 943145 | 943423 | + | NZ_CP015217.1 | Leptospira tipperaryensis |
| 4 | 3327262 | 3327540 | + | NZ_CP040840.1 | Leptospira weilii |
| 5 | 577355 | 577633 | + | NZ_CP030142.1 | Leptospira mayottensis |
| 6 | 559478 | 559756 | - | NZ_CP026671.1 | Leptospira borgpetersenii serovar Ceylonica |
| 7 | 497105 | 497383 | + | NC_017464.1 | Ignavibacterium album JCM 16511 |
| 8 | 730387 | 730617 | + | NZ_AP017312.1 | Aneurinibacillus soli |
| 9 | 2967368 | 2967628 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 10 | 3221223 | 3221456 | - | NC_018178.1 | Melioribacter roseus P3M-2 |
| 11 | 1825764 | 1826057 | - | NC_018664.1 | Gottschalkia acidurici 9a |
| 12 | 831606 | 831851 | - | NZ_CP069440.1 | Phocaeicola coprophilus |
| 13 | 1078740 | 1078985 | + | NC_015164.1 | Phocaeicola salanitronis DSM 18170 |
| 14 | 1025447 | 1025674 | + | NC_014926.1 | Thermovibrio ammonificans HB-1 |
| 15 | 631541 | 631819 | + | NC_014614.1 | Acetoanaerobium sticklandii |
| 16 | 2920538 | 2920843 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 17 | 848693 | 848980 | + | NC_014633.1 | Ilyobacter polytropus DSM 2926 |
| 18 | 2627546 | 2627791 | - | NZ_CP015401.2 | Bacteroides caecimuris |
| 19 | 1494352 | 1494579 | + | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 20 | 1720258 | 1720485 | + | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 21 | 1713479 | 1713706 | + | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 22 | 4539173 | 4539430 | - | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 23 | 2357976 | 2358245 | - | NZ_CP019870.1 | Clostridioides difficile |
| 24 | 2079471 | 2079725 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 25 | 639085 | 639381 | + | NZ_CP014223.1 | Anaerotignum propionicum DSM 1682 |
| 26 | 1308627 | 1308920 | - | NC_013192.1 | Leptotrichia buccalis C-1013-b |
| 27 | 3253282 | 3253518 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 28 | 2460311 | 2460595 | + | NZ_CP011058.1 | Paenibacillus beijingensis |
| 29 | 856564 | 856794 | - | NZ_CP029256.1 | Christensenella minuta |
| 30 | 204691 | 204996 | + | NZ_CP009687.1 | Clostridium aceticum |
| 31 | 966834 | 967103 | + | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 32 | 1750503 | 1750835 | + | NZ_CP028842.1 | Clostridium botulinum |
| 33 | 473584 | 473838 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 34 | 848171 | 848437 | - | NZ_CP034248.1 | Paenibacillus lentus |
| 35 | 685365 | 685682 | - | NZ_LR134483.1 | Listeria grayi |
| 36 | 1113057 | 1113350 | - | NZ_AP019829.2 | Leptotrichia wadei |
| 37 | 1250529 | 1250846 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 38 | 1767573 | 1767818 | + | NZ_CP011663.1 | Clostridium sporogenes |
| 39 | 2657421 | 2657663 | - | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 40 | 4803614 | 4803844 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 41 | 562784 | 563095 | - | NZ_LT906444.1 | Listeria welshimeri |
| 42 | 500236 | 500535 | + | NZ_CP012024.1 | Bacillus smithii |
| 43 | 1754752 | 1755075 | - | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 44 | 204544 | 204822 | + | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 45 | 1762830 | 1763057 | + | NC_023151.1 | Thermotoga maritima MSB8 |
| 46 | 368331 | 368651 | + | NZ_CP017713.1 | Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001 |
| 47 | 751920 | 752201 | + | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 48 | 1783026 | 1783274 | + | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 49 | 5454496 | 5454771 | - | NZ_CP020028.1 | Paenibacillus kribbensis |
| 50 | 1383159 | 1383491 | - | NC_014334.2 | Lacticaseibacillus paracasei |
| 51 | 3366493 | 3366732 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 52 | 1114854 | 1115144 | + | NZ_CP034437.1 | Paenibacillus albus |
| 53 | 4068374 | 4068637 | - | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 54 | 1064423 | 1064716 | + | NZ_AP019827.1 | Leptotrichia shahii |
| 55 | 2574052 | 2574339 | + | NZ_CP048649.1 | Aminipila butyrica |
| 56 | 22544 | 22789 | + | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 57 | 3318207 | 3318485 | - | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 58 | 3325707 | 3325943 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 59 | 2619799 | 2620077 | + | NC_016894.1 | Acetobacterium woodii DSM 1030 |
| 60 | 2517484 | 2517774 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 61 | 2652662 | 2652949 | + | NZ_CP011388.1 | Paenibacillus swuensis |
| 62 | 3979573 | 3979809 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 63 | 172743 | 173018 | + | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 64 | 2487136 | 2487363 | - | NC_014654.1 | Halanaerobium hydrogeniformans |
| 65 | 3975662 | 3975979 | + | NC_016048.1 | Oscillibacter valericigenes Sjm18-20 |
| 66 | 3032369 | 3032656 | - | NZ_CP016809.1 | Paenibacillus ihbetae |
| 67 | 1405656 | 1405883 | - | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 68 | 5043522 | 5043809 | - | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 69 | 176309 | 176629 | - | NZ_CP018796.1 | Lentilactobacillus parabuchneri |
| 70 | 2995265 | 2995519 | - | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
| 71 | 2816324 | 2816548 | - | NZ_CP045875.1 | Heliorestis convoluta |
| 72 | 1430203 | 1430514 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 73 | 185926 | 186258 | + | NC_008593.1 | Clostridium novyi NT |
| 74 | 1593948 | 1594250 | - | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 75 | 2486178 | 2486465 | + | NZ_CP045298.1 | Paenibacillus brasilensis |
| 76 | 1078800 | 1079039 | - | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 77 | 481802 | 482092 | + | NZ_CP048209.1 | Paenibacillus lycopersici |
| 78 | 484842 | 485135 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 79 | 1150256 | 1150504 | + | NZ_CP026363.1 | Brevibacillus agri |
| 80 | 5516882 | 5517148 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 81 | 3387993 | 3388250 | - | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 82 | 579371 | 579655 | - | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 83 | 305357 | 305677 | - | NZ_CP029971.1 | Lentilactobacillus kefiri |
| 84 | 2393179 | 2393466 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 85 | 1364276 | 1364608 | + | NZ_CP019323.1 | Companilactobacillus allii |
| 86 | 3533707 | 3533949 | - | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 87 | 1770663 | 1770980 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 88 | 3731217 | 3731513 | - | NC_019897.1 | Thermobacillus composti KWC4 |
| 89 | 1227619 | 1227903 | - | NZ_CP034413.2 | Dysosmobacter welbionis |
| 90 | 63464 | 63703 | + | NZ_LT990039.1 | Massilistercora timonensis |
| 91 | 2564482 | 2564754 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 92 | 1616432 | 1616734 | + | NC_014136.1 | Leuconostoc kimchii IMSNU 11154 |
| 93 | 2064932 | 2065219 | + | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 94 | 1565540 | 1565836 | - | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
| 95 | 2835751 | 2836071 | + | NZ_CP011102.1 | Listeria weihenstephanensis |
| 96 | 1338468 | 1338785 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 97 | 2992648 | 2992974 | - | NZ_CP030280.1 | Blautia argi |
| 98 | 516382 | 516696 | - | NZ_CP042374.1 | Leuconostoc carnosum |
| 99 | 1566698 | 1567012 | - | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 100 | 2135549 | 2135815 | + | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 101 | 2356281 | 2356574 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 102 | 1082495 | 1082800 | + | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 103 | 3622011 | 3622277 | - | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 104 | 3455071 | 3455361 | - | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 105 | 160550 | 160837 | + | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 106 | 3352658 | 3352915 | - | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 107 | 7216509 | 7216757 | + | NZ_CP021780.1 | Paenibacillus donghaensis |
| 108 | 2074740 | 2075006 | + | NZ_CP048429.1 | Paenibacillus jilunlii |
| 109 | 97096 | 97338 | + | NZ_LR130778.1 | Petrocella atlantisensis |
| 110 | 1686847 | 1687137 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 111 | 1244566 | 1244877 | + | NZ_CP047121.1 | Lentilactobacillus hilgardii |
| 112 | 701476 | 701745 | + | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 113 | 578148 | 578459 | - | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 114 | 787103 | 787396 | + | NC_020995.1 | Enterococcus casseliflavus EC20 |
| 115 | 2995349 | 2995573 | - | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 116 | 2120259 | 2120549 | - | NZ_CP016786.1 | Clostridium isatidis |
| 117 | 4105054 | 4105323 | - | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 118 | 1737980 | 1738207 | - | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 119 | 204562 | 204849 | + | NZ_CP009286.1 | Paenibacillus stellifer |
| 120 | 164655 | 164909 | + | NZ_CP009428.1 | Paenibacillus odorifer |
| 121 | 3637482 | 3637739 | + | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 122 | 499568 | 499879 | - | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 123 | 2031715 | 2031981 | + | NZ_CP068595.1 | Paenibacillus sonchi |
| 124 | 162097 | 162384 | + | NZ_CP009288.1 | Paenibacillus durus |
| 125 | 1247220 | 1247525 | + | NZ_LS483476.1 | Lederbergia lentus |
| 126 | 2621176 | 2621502 | - | NZ_CP030775.1 | Clostridium butyricum |
| 127 | 767672 | 767899 | + | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 128 | 1183591 | 1183893 | + | NZ_CP070872.1 | Lactococcus taiwanensis |
| 129 | 1404589 | 1404849 | + | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 130 | 152769 | 153080 | + | NZ_LR134375.1 | Veillonella dispar |
| 131 | 632384 | 632704 | + | NC_018631.1 | Leuconostoc gelidum JB7 |
| 132 | 125918 | 126184 | - | NZ_CP018906.1 | Lentilactobacillus curieae |
| 133 | 165986 | 166252 | + | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 134 | 600837 | 601148 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
| 135 | 2018409 | 2018633 | - | NC_008346.1 | Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 |
| 136 | 2006995 | 2007240 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 137 | 1208958 | 1209245 | - | NZ_LS483343.1 | Streptococcus ferus |
| 138 | 189158 | 189484 | + | NZ_LR778174.1 | Veillonella parvula |
| 139 | 156471 | 156719 | + | NZ_CP009285.1 | Paenibacillus borealis |
| 140 | 1430928 | 1431242 | - | NZ_LR594049.1 | Streptococcus gordonii |
| 141 | 706686 | 706961 | + | NZ_CP011361.2 | Salimicrobium jeotgali |
| 142 | 3013687 | 3013956 | - | NZ_CP040924.1 | Clostridium thermarum |
| 143 | 1492909 | 1493172 | + | NC_015387.1 | Marinithermus hydrothermalis DSM 14884 |
| 144 | 3158857 | 3159114 | - | NC_017098.1 | Spirochaeta africana DSM 8902 |
| 145 | 1319702 | 1319947 | + | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 146 | 665747 | 665974 | + | NZ_CP014699.1 | Streptococcus pantholopis |
| 147 | 896361 | 896675 | + | NZ_CP029491.1 | Streptococcus sobrinus |
| 148 | 365983 | 366309 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 149 | 71079 | 71306 | - | NZ_CP054015.1 | Streptococcus gallolyticus |
| 150 | 1415994 | 1416221 | - | NZ_CP039457.1 | Streptococcus pasteurianus |
| 151 | 4394326 | 4394607 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 152 | 271248 | 271520 | + | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 153 | 3450172 | 3450408 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 154 | 595227 | 595463 | + | NZ_CP011937.1 | Bacillus velezensis |
| 155 | 2612601 | 2612888 | - | NC_014960.1 | Anaerolinea thermophila UNI-1 |
| 156 | 500424 | 500705 | + | NZ_CP016312.1 | Thermus brockianus |
| 157 | 3513870 | 3514196 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 158 | 2229136 | 2229369 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 159 | 2167221 | 2167454 | + | NZ_CP043404.1 | Bacillus safensis |
| 160 | 3300902 | 3301186 | - | NZ_CP019699.1 | Novibacillus thermophilus |
| 161 | 3385373 | 3385606 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 162 | 3447111 | 3447344 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 163 | 3582936 | 3583175 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 164 | 1617151 | 1617462 | - | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 165 | 3406166 | 3406399 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 166 | 602532 | 602777 | + | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 167 | 3439070 | 3439303 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 168 | 232069 | 232326 | + | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 169 | 3750103 | 3750342 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 170 | 3365797 | 3366027 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 171 | 2670085 | 2670315 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 172 | 541803 | 542090 | - | NC_014122.1 | Methanocaldococcus infernus ME |
| 173 | 3556149 | 3556388 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 174 | 1337004 | 1337246 | + | NC_014761.1 | Oceanithermus profundus DSM 14977 |
| 175 | 3131066 | 3131299 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 176 | 192570 | 192881 | + | NZ_LT906470.1 | Veillonella rodentium |
| 177 | 158091 | 158360 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 178 | 2275282 | 2275581 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 179 | 1376785 | 1377012 | + | NZ_CP010822.1 | Thermus aquaticus Y51MC23 |
| 180 | 757484 | 757780 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 181 | 2733499 | 2733798 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 182 | 550272 | 550559 | + | NZ_CP043552.1 | Francisella marina |
| 183 | 561188 | 561445 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 184 | 2437137 | 2437406 | - | NZ_CP034118.1 | Staphylospora marina |
| 185 | 3680006 | 3680245 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 186 | 2180242 | 2180544 | + | NC_014212.1 | Meiothermus silvanus DSM 9946 |
| 187 | 1920678 | 1920950 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 188 | 1631596 | 1631859 | - | NZ_CP009654.1 | Francisella frigiditurris |
| 189 | 294322 | 294561 | + | NZ_CP070062.1 | Coprococcus comes |
| 190 | 204413 | 204703 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 191 | 3091042 | 3091338 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 192 | 1962123 | 1962419 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 193 | 1213306 | 1213593 | + | NC_015696.1 | Francisella salina |
| 194 | 1135671 | 1135913 | + | NZ_LN879430.1 | Herbinix luporum |
| 195 | 1778993 | 1779289 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 196 | 1361725 | 1362012 | - | NZ_CP016796.1 | Francisella uliginis |
| 197 | 811192 | 811479 | + | NZ_CP021781.1 | Francisella adeliensis |
| 198 | 624034 | 624267 | - | NZ_CP014141.1 | Thermus parvatiensis |
| 199 | 1373390 | 1373623 | + | NC_006461.1 | Thermus thermophilus HB8 |
| 200 | 746825 | 747061 | + | NZ_CP022132.1 | Francisella halioticida |
| 201 | 1147110 | 1147343 | + | NZ_CP038452.1 | Thermus caldilimi |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017464.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00475.20 | 0.85 | 171 | 2507 | same-strand | Imidazoleglycerol-phosphate dehydratase |
| 2 | PF00117.30 | 0.8 | 161 | 1876 | same-strand | Glutamine amidotransferase class-I |
| 3 | PF00977.23 | 0.91 | 182 | 726 | same-strand | Histidine biosynthesis protein |
++ More..